KEGG   Xenopus laevis (African clawed frog): 446722Help
Entry
446722            CDS       T01010                                 

Gene name
ppox
Definition
protoporphyrinogen oxidase (EC:1.3.3.4)
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xla00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    446722 (ppox)
Enzymes [BR:xla01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     446722 (ppox)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
AA seq 474 aa AA seqDB search
MQRTVVVAGGGISGLTACYHLAKDARVSKVILLEGSSRLGGWMHSTRTEDGAVFEHGPRG
IRPGGVVGRNTLCMVSELGLQQEILPVPRSHPAAKDRYLYVNKSLHKLPSSVGGVLRTIP
PFTRPLFLCGLRDLAAPRGSKEDESIYDFVARRFGKELADIVIDSLCRGVFAGDCRSLSV
RSCFPFLYEAEVKRRSVILGMATAGEKGPPVDSELIRRSKQERWSQWSLEGGMQTLSEAL
EDFLRNRGVEIHKDTPIRQLERTAGNGWKIKLPDGSISADYIFSALPAKDLSSLLPQDLE
PLVKELQQMSSATVAVVNLQYEGDVLPISGFGHLIPSSEDRALLGIVYDSIAFPQHNKRG
SSSTRLTVMLGGAWFQSSIGDPDTVSSEKVLELATTAAAEQLGVREKPSRSIVNINKDCI
PQYTLGHWSRTGNLSTYIRQVNLPLSLVGASYHGVSVNDCIYNAKQAVHNLLGH
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
atgcagaggacggtggtggtcgcaggaggggggatcagtggactaacggcttgttatcat
ctggccaaagatgcccgtgtgtccaaggtgatattgctggaggggagcagcaggcttggg
gggtggatgcactccactcggactgaagatggcgctgtctttgaacatgggcccagaggg
atccgtcccggaggagtggtggggaggaatactctgtgcatggtatcagagctcggttta
caacaagagatccttccggtcccccgaagtcaccctgcggccaaggatcgatacctctac
gtcaacaagtctctgcacaaactcccatccagtgtaggtggggtgttgcggaccatcccc
ccctttaccaggccgttattcctctgcggcctccgggatctggctgcgccgaggggctct
aaggaggacgagagtatctacgactttgtcgccaggcgttttgggaaagagctggcagac
attgtcatcgacagcttgtgccgcggagtgtttgccggagactgccgaagcctcagcgtg
cgctcctgtttccccttcctttatgaagcagaagtcaagaggagatcagtcattctgggg
atggcaacagccggggagaaaggcccccctgtggactctgaactgatccgaagatccaaa
caggagcgctggagtcagtggtccctggagggtgggatgcagaccctctccgaagcactg
gaggacttcctgaggaatagaggggttgaaattcacaaggacacgcccatacggcagttg
gaaaggacggcaggcaatggatggaagatcaagcttccagacggcagcatctccgctgat
tatatattcagtgctcttcctgcaaaagatctgagctccctgctcccccaagacttggaa
cctttagtaaaagagctgcagcagatgagttcagccactgtggctgtagtgaatctacaa
tatgagggggacgttcttcccatttcgggctttgggcacctgataccatcatcggaggac
agagctctgctggggatagtgtatgattccattgccttcccacagcacaacaagcgcggc
tccagctccacccgacttacggtgatgttggggggcgcgtggttccaaagcagcatagga
gaccccgacaccgtttcttccgagaaggttctagagctggcaacgactgcggcggctgag
cagctgggagtgcgagagaagccaagtcggagtatagtgaacattaataaggactgcatc
cctcaatacaccctgggacactggagtcgcacaggaaacctctccacctatatccgccag
gttaacttgcctctgagcctggtcggcgcctcataccacggagtctctgtaaatgactgt
atctataacgctaagcaagctgtgcacaaccttttggggcattag

DBGET integrated database retrieval system