KEGG   Xenopus laevis (African clawed frog): 446738Help
Entry
446738            CDS       T01010                                 

Gene name
adh7, adh6
Definition
alcohol dehydrogenase 7 (class IV), mu or sigma polypeptide (EC:1.1.1.1)
Orthology
K13951  
alcohol dehydrogenase 1/7 [EC:1.1.1.1]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Retinol metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xla00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    446738 (adh7)
  Lipid metabolism
   00071 Fatty acid degradation
    446738 (adh7)
  Amino acid metabolism
   00350 Tyrosine metabolism
    446738 (adh7)
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    446738 (adh7)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    446738 (adh7)
   00982 Drug metabolism - cytochrome P450
    446738 (adh7)
Enzymes [BR:xla01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     446738 (adh7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
AA seq 378 aa AA seqDB search
MESAGQVIKCKAAVTWGKNAPFSIEEIEVAPPKAHEVRIKMIATGICRSDHHSIEGKFSS
VKFPVIVGHEGVGIVESIGEGVKDIKPGDKVIPLVTPQCGQCQCCKDPRANRCLTIKLER
QYGLMADGTSRFTCRGKQIYHFLNTSTFTEYTVVEEIAVAKIDDTATMDSVCLIGCAFST
GYGSVINTAKVHPGSTCVIFGLGGIGLAVIMGCKIAGAGRIIGVDVNPDKFDKAKELGAT
ECINPKDYDKPVAQVIVEQTGGGVDYAFECVGHAETMLAALHSSHFAYGTTVIIGVSAST
LSFDPMILLSGRTLKSSMLGGWKSKDSVPKLVSDYLAKKFDLEKLVTHRLPFQKIDEGFD
LLLSGKCIRTILTFKAVD
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
atggaatcagcaggacaagttatcaaatgcaaggctgcagtgacttggggaaaaaatgca
cccttttcgattgaggagatagaagttgctcccccaaaagcccatgaagtccgtattaag
atgatagcaacaggtatctgtcggtcagatcaccattcaattgaggggaaattttcatct
gtaaaattcccagttattgttggccatgaaggagttggtattgttgaaagcattggcgaa
ggtgtgaaagacattaagccaggagacaaagtcattccacttgtcacacctcaatgtgga
cagtgtcagtgttgtaaggatccaagggctaatagatgcctcacaatcaaactggaaagg
caatatggactcatggctgatggcaccagcagattcacctgcagagggaagcaaatctac
cacttcctgaacaccagcacctttactgaatacactgtagttgaggaaatagcagttgct
aagattgatgatactgcaacaatggatagtgtctgtctcattggctgtgctttctccact
ggctatgggtctgtaataaatactgccaaggtgcacccaggatcgacgtgtgtcatattt
ggtttaggaggtattgggcttgctgtcattatgggatgtaagatagctggggctggtcgc
atcattggagtagatgtcaatcctgacaaatttgacaaagcaaaggaactaggagctact
gaatgcataaaccccaaggattatgataaaccagtagcacaagtgattgtggagcagact
ggaggtggtgtagactatgcatttgaatgtgttggccacgctgagactatgttagcggca
ttacactccagtcactttgcatatggaactacagtcataattggagtatctgcatcaact
ctttcctttgatccaatgatccttttgtctggtcgcacactgaaaagctctatgcttgga
ggctggaaatccaaagactctgttccaaaattagtttcagattacttggcaaaaaaattt
gacctggaaaagttggtgacgcaccgattaccttttcagaagatcgatgaaggatttgat
cttttgctttctggaaaatgcattcggacaatcttaacatttaaagcagtggattga

DBGET integrated database retrieval system