KEGG   Xenopus laevis (African clawed frog): 446756Help
Entry
446756            CDS       T01010                                 

Gene name
pfkm, pfk
Definition
phosphofructokinase, muscle (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Metabolic pathways
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Class
Metabolism; Overview; Carbon metabolism [PATH:xla01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:xla01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:xla00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:xla00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:xla00051]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:xla00052]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
AA seq 808 aa AA seqDB search
MATLLNLEDFDEPETRPDTSYYNTDKTMLPAGSKHHDAQTMGIGKAIAVLTSGGDAQGMN
AAVRAVVRVGIYTGAKVYFVHEGYQGLVDGGDNIKEASWESVSMMLQLGGTVIGSARCQD
FRGREGRLKAACNLVKKGITNLCVIGGDGSLTGADTFRSEWSGLLADLVKADTITEDEAK
KSSYLNIVGLVGSIDNDFCGTDMTIGTDSALHRIMEIVDAITTTAQSHQRTFVLEVMGRH
CGYLALVTALACGADWVFVPESPPEENWEEHLCRRLSETRGRGSRLNIIIVAEGAIDLHG
KPITSDLIKDLVIKRLGYDTRVTVLGHVQRGGTPSAFDRILGSRMGVEAVMALLEGTPDT
PACVVSLSGNQAIRLPLMECVQVTKEVTQAMNEKKFEEALKLRGKSFENNWKVYRTLAHI
RPPSAKSGYNLAVLNVGAPAAGMNAAVRSTVRIGIIQGHRMFAVHDGFEGLAKGQIEEIG
WSGVGGWTGQGGSRLGTKRTLPKKYFEEISNNISNYNIHGLIIVGGFEAFTGSLELMEGR
CKYEELCIPIVVIPATVSNNVPGSDFSIGADTALNTITVTCDRIKQSAAGTKRRVFIIET
MGGYCGYLATMAGFAAGADAAYIYEESVNIHELQTNVEHLTEKMKTTVKRGLILRNEKCN
DNYSTDFIFNLYSEEGKGVFDCRKNVLGHMQQGGTPTPFDRNFGTKMGAKAVLWMTGKVK
ECSRHGRIFANTPDSACLLGMRKRSLVFQPLVELKEQTDFAHRLPKEQWWLKLRPILKIL
AKYKINLDTSDHAHMEHITRKTSHPTNI
NT seq 2427 nt NT seq  +upstreamnt  +downstreamnt
atggcgaccctattaaatctcgaagacttcgacgaaccagaaacgaggcctgatacctca
tactataacactgataaaacaatgctgcctgcaggatcgaaacatcacgatgctcaaact
atgggcatcggaaaagccatcgctgtgctgacatcaggaggcgatgcacaaggaatgaat
gccgctgtcagagcagtagtgagagtaggaatttacacaggtgccaaagtctactttgta
catgagggataccaaggattggttgacggaggtgacaacatcaaagaagcctcatgggaa
agcgtttcaatgatgctgcagttgggtgggacagttatagggagtgcaagatgtcaagat
ttccgaggccgagagggtcgacttaaagcagcctgcaatttggtaaagaaaggaattacc
aacttgtgtgttattggtggagacggcagcttgactggagcagacacttttagatcagaa
tggagcggcttgctggctgatttagtgaaagcagatactattactgaagatgaagccaaa
aagtccagttatctgaatatcgttggcttggttggatccattgataatgatttctgtggg
acggatatgacaatcggcacagattctgccttgcataggataatggaaatagtagatgcc
atcacaaccactgcacaaagtcaccagaggacctttgttcttgaagtgatgggtcgacac
tgcgggtatttggccttggtaacagcccttgcatgtggtgctgattgggttttcgttcca
gaatcaccacctgaagaaaactgggaagaacatctttgtagaaggttaagtgagacgaga
ggacgtggatcacggcttaacattatcattgttgctgaaggagcaattgatttacatggc
aaacccattacatctgatctcattaaagatttagtgataaaacgtcttggttatgacaca
agggtcactgtgcttggccatgttcagcgaggtggaacaccatctgccttcgacagaata
ttgggaagccgaatgggtgttgaagctgtgatggccctattggagggaaccccagataca
ccagcttgtgtggtcagtttgtctggaaatcaagccattagacttccattgatggaatgc
gtacaagtgactaaggaggtgacacaagccatgaatgagaagaagtttgaagaggccttg
aaattacgaggaaagagttttgaaaataactggaaggtttatagaacattggctcatatc
agacctccatctgcaaagagtgggtataatctggctgttctgaatgttggagcacctgca
gcaggtatgaacgcagcagtgagatccacagtgagaattggcattattcaaggtcacaga
atgtttgctgttcatgatggatttgaaggacttgcaaaaggacagattgaagaaattgga
tggagcggtgttggtggatggactggacaaggaggatcccgtcttggcactaagaggact
ctgcccaagaaatactttgaagaaatcagtaataacataagcaactataatatacatggg
ctaatcattgtcggcggttttgaggcatttacaggcagcttggaacttatggaaggacga
tgcaagtatgaagagctatgcatacccattgttgttatccctgccactgtatcaaataat
gttcccggatctgatttcagtattggagcagatacggctctcaatactattacagttacc
tgcgatcgaatcaagcagtctgccgctggaactaagcgcagagtctttatcattgagacc
atgggaggttactgtggttatctggctactatggcaggatttgctgctggtgccgacgca
gcttacatttatgaagaatctgtgaacatacatgaattgcaaacaaatgtcgagcacctt
acagaaaaaatgaagaccacagtaaaaagaggtttaatactgaggaatgagaagtgcaat
gacaactattccacagattttatatttaatctatattctgaagaaggaaaaggtgttttt
gactgcaggaagaatgtccttggtcacatgcagcagggtggaacgcctaccccctttgat
agaaactttggcacaaaaatgggtgcaaaggccgttctttggatgacagggaaagtaaag
gaatgctctagacatggccgcatttttgccaatacgccagactctgcttgtttgcttgga
atgcgcaagcgaagtcttgttttccagcctctagttgaacttaaggagcagactgatttt
gcccatcgtctccctaaggaacagtggtggctgaaacttcgccctatcctgaaaattctt
gcaaaatataaaatcaacctggacacatctgaccatgcacatatggaacacattacacgt
aagacatctcatccaaccaatatctag

DBGET integrated database retrieval system