KEGG   Xenopus laevis (African clawed frog): 446756Help
Entry
446756            CDS       T01010                                 

Gene name
pfkm, pfk
Definition
(RefSeq) phosphofructokinase, muscle (EC:2.7.1.11)
  KO
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Metabolic pathways
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:xla00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    446756 (pfkm)
   01230 Biosynthesis of amino acids
    446756 (pfkm)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    446756 (pfkm)
   00030 Pentose phosphate pathway
    446756 (pfkm)
   00051 Fructose and mannose metabolism
    446756 (pfkm)
   00052 Galactose metabolism
    446756 (pfkm)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    446756 (pfkm)
Enzymes [BR:xla01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     446756 (pfkm)
Protein phosphatases and associated proteins [BR:xla01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     446756 (pfkm)
Messenger RNA biogenesis [BR:xla03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     446756 (pfkm)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
AA seq 808 aa AA seqDB search
MATLLNLEDFDEPETRPDTSYYNTDKTMLPAGSKHHDAQTMGIGKAIAVLTSGGDAQGMN
AAVRAVVRVGIYTGAKVYFVHEGYQGLVDGGDNIKEASWESVSMMLQLGGTVIGSARCQD
FRGREGRLKAACNLVKKGITNLCVIGGDGSLTGADTFRSEWSGLLADLVKADTITEDEAK
KSSYLNIVGLVGSIDNDFCGTDMTIGTDSALHRIMEIVDAITTTAQSHQRTFVLEVMGRH
CGYLALVTALACGADWVFVPESPPEENWEEHLCRRLSETRGRGSRLNIIIVAEGAIDLHG
KPITSDLIKDLVIKRLGYDTRVTVLGHVQRGGTPSAFDRILGSRMGVEAVMALLEGTPDT
PACVVSLSGNQAIRLPLMECVQVTKEVTQAMNEKKFEEALKLRGKSFENNWKVYRTLAHI
RPPSAKSGYNLAVLNVGAPAAGMNAAVRSTVRIGIIQGHRMFAVHDGFEGLAKGQIEEIG
WSGVGGWTGQGGSRLGTKRTLPKKYFEEISNNISNYNIHGLIIVGGFEAFTGSLELMEGR
CKYEELCIPIVVIPATVSNNVPGSDFSIGADTALNTITVTCDRIKQSAAGTKRRVFIIET
MGGYCGYLATMAGFAAGADAAYIYEESVNIHELQTNVEHLTEKMKTTVKRGLILRNEKCN
DNYSTDFIFNLYSEEGKGVFDCRKNVLGHMQQGGTPTPFDRNFGTKMGAKAVLWMTGKVK
ECSRHGRIFANTPDSACLLGMRKRSLVFQPLVELKEQTDFAHRLPKEQWWLKLRPILKIL
AKYKINLDTSDHAHMEHITRKTSHPTNI
NT seq 2427 nt NT seq  +upstreamnt  +downstreamnt
atggcgaccctattaaatctcgaagacttcgacgaaccagaaacgaggcctgatacctca
tactataacactgataaaacaatgctgcctgcaggatcgaaacatcacgatgctcaaact
atgggcatcggaaaagccatcgctgtgctgacatcaggaggcgatgcacaaggaatgaat
gccgctgtcagagcagtagtgagagtaggaatttacacaggtgccaaagtctactttgta
catgagggataccaaggattggttgacggaggtgacaacatcaaagaagcctcatgggaa
agcgtttcaatgatgctgcagttgggtgggacagttatagggagtgcaagatgtcaagat
ttccgaggccgagagggtcgacttaaagcagcctgcaatttggtaaagaaaggaattacc
aacttgtgtgttattggtggagacggcagcttgactggagcagacacttttagatcagaa
tggagcggcttgctggctgatttagtgaaagcagatactattactgaagatgaagccaaa
aagtccagttatctgaatatcgttggcttggttggatccattgataatgatttctgtggg
acggatatgacaatcggcacagattctgccttgcataggataatggaaatagtagatgcc
atcacaaccactgcacaaagtcaccagaggacctttgttcttgaagtgatgggtcgacac
tgcgggtatttggccttggtaacagcccttgcatgtggtgctgattgggttttcgttcca
gaatcaccacctgaagaaaactgggaagaacatctttgtagaaggttaagtgagacgaga
ggacgtggatcacggcttaacattatcattgttgctgaaggagcaattgatttacatggc
aaacccattacatctgatctcattaaagatttagtgataaaacgtcttggttatgacaca
agggtcactgtgcttggccatgttcagcgaggtggaacaccatctgccttcgacagaata
ttgggaagccgaatgggtgttgaagctgtgatggccctattggagggaaccccagataca
ccagcttgtgtggtcagtttgtctggaaatcaagccattagacttccattgatggaatgc
gtacaagtgactaaggaggtgacacaagccatgaatgagaagaagtttgaagaggccttg
aaattacgaggaaagagttttgaaaataactggaaggtttatagaacattggctcatatc
agacctccatctgcaaagagtgggtataatctggctgttctgaatgttggagcacctgca
gcaggtatgaacgcagcagtgagatccacagtgagaattggcattattcaaggtcacaga
atgtttgctgttcatgatggatttgaaggacttgcaaaaggacagattgaagaaattgga
tggagcggtgttggtggatggactggacaaggaggatcccgtcttggcactaagaggact
ctgcccaagaaatactttgaagaaatcagtaataacataagcaactataatatacatggg
ctaatcattgtcggcggttttgaggcatttacaggcagcttggaacttatggaaggacga
tgcaagtatgaagagctatgcatacccattgttgttatccctgccactgtatcaaataat
gttcccggatctgatttcagtattggagcagatacggctctcaatactattacagttacc
tgcgatcgaatcaagcagtctgccgctggaactaagcgcagagtctttatcattgagacc
atgggaggttactgtggttatctggctactatggcaggatttgctgctggtgccgacgca
gcttacatttatgaagaatctgtgaacatacatgaattgcaaacaaatgtcgagcacctt
acagaaaaaatgaagaccacagtaaaaagaggtttaatactgaggaatgagaagtgcaat
gacaactattccacagattttatatttaatctatattctgaagaaggaaaaggtgttttt
gactgcaggaagaatgtccttggtcacatgcagcagggtggaacgcctaccccctttgat
agaaactttggcacaaaaatgggtgcaaaggccgttctttggatgacagggaaagtaaag
gaatgctctagacatggccgcatttttgccaatacgccagactctgcttgtttgcttgga
atgcgcaagcgaagtcttgttttccagcctctagttgaacttaaggagcagactgatttt
gcccatcgtctccctaaggaacagtggtggctgaaacttcgccctatcctgaaaattctt
gcaaaatataaaatcaacctggacacatctgaccatgcacatatggaacacattacacgt
aagacatctcatccaaccaatatctag

DBGET integrated database retrieval system