KEGG   Xenopus laevis (African clawed frog): 446786Help
Entry
446786            CDS       T01010                                 

Gene name
pik3r2
Definition
phosphoinositide-3-kinase, regulatory subunit, polypeptide 2 (p85 beta)
Orthology
K02649  
phosphoinositide-3-kinase, regulatory subunit
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
ErbB signaling pathway
FoxO signaling pathway
Phosphatidylinositol signaling system
mTOR signaling pathway
Apoptosis
Adrenergic signaling in cardiomyocytes
VEGF signaling pathway
Focal adhesion
Toll-like receptor signaling pathway
Jak-STAT signaling pathway
Regulation of actin cytoskeleton
Insulin signaling pathway
Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:xla00001]
 Environmental Information Processing
  Signal transduction
   04012 ErbB signaling pathway
    446786 (pik3r2)
   04370 VEGF signaling pathway
    446786 (pik3r2)
   04630 Jak-STAT signaling pathway
    446786 (pik3r2)
   04068 FoxO signaling pathway
    446786 (pik3r2)
   04070 Phosphatidylinositol signaling system
    446786 (pik3r2)
   04150 mTOR signaling pathway
    446786 (pik3r2)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    446786 (pik3r2)
  Cell growth and death
   04210 Apoptosis
    446786 (pik3r2)
  Cellular commiunity
   04510 Focal adhesion
    446786 (pik3r2)
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    446786 (pik3r2)
  Endocrine system
   04910 Insulin signaling pathway
    446786 (pik3r2)
   04914 Progesterone-mediated oocyte maturation
    446786 (pik3r2)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    446786 (pik3r2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 457 aa AA seqDB search
MYNTVWNMDQDDADWREVMMPYSTELIFYIEMDPPALPPKPPKSMTSLSTDGSKENSTSS
LQDAEWYWGDIAREEVNDKLRDMPDGTFLVRDASSKVQGDYTLTLRKGCNNKLIKIYHQD
GKYGFSDPLTFNSVVELINHYRHESLAQYNPKLDVKLLYPVSRYQQDQLVKEDNIDAVGR
KLQEYHSQFQDKSKAYDQLYEEYTKTSQEIQMKRTAIEAFNETIKIFEEQCHTQECYSKD
YMEHFNREGNEKEMERIIMSYEKLKSRLGDVHDSKLRLEQDLKTQALDNREIDKKMNSIK
PDLIQLRKIRDQYLVWLNHKGVRQKRINDWLGIKNENIDDEEPDNLPHFDEKTWFVGDLG
RIQAEELLSGKPDGAFLIRESSKKGCYACSVVADGDVKHCVIYSTSRGYGFAEPYNLYST
LKELVLHYQHTSLVQHNDSLNVRLAYPVYAQMPSLCR
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
atgtacaacactgtgtggaatatggaccaagatgatgcagactggagggaagttatgatg
ccttattccaccgaactgatcttttatatagagatggaccccccagcacttcctcctaaa
ccaccaaaatccatgacttcattgtctacagacggaagcaaagagaactccacttcttct
cttcaggatgccgaatggtactggggagacatcgccagggaagaggtaaatgataaactt
cgtgatatgccagatggtaccttcctggttcgagatgcatcttccaaagttcaaggcgat
tatactttgacactgcggaaagggtgcaataacaaactgataaagatttatcatcaggat
ggcaaatatggtttttctgatccgttgacatttaactctgttgtggagttgataaaccat
tatagacacgaatccttggcacaatacaatcctaaactggatgtgaagttattatatcca
gtatcaagataccagcaggatcagcttgttaaagaagataacattgatgctgttggtagg
aaacttcaagaataccatagtcagtttcaggataaaagcaaagcatacgatcaattgtac
gaagaatatacaaaaacatcacaggaaattcagatgaagagaacagcaattgaagccttt
aacgagactattaaaatatttgaagaacagtgccatacacaagaatgctatagtaaagat
tacatggagcatttcaatagggagggcaatgaaaaggaaatggaaaggataataatgagt
tatgaaaaattaaaatctcgtttgggtgacgttcatgacagtaaattacgcctggaacaa
gacttgaagacgcaagctttagacaatagagaaatagacaagaaaatgaacagtatcaaa
cctgatcttattcagctacgtaaaataagagatcaataccttgtatggcttaatcacaaa
ggagtgaggcaaaaacgaataaatgactggctgggaatcaagaatgaaaatattgatgat
gaggagcctgataaccttccacattttgatgagaaaacctggtttgttggtgatcttggc
cgtatacaagcagaagaattactcagtggaaagccagatggagcctttctaattcgagaa
agtagcaagaagggatgctatgcctgttctgttgtggctgatggtgatgtgaagcactgt
gtcatctacagtacgtcaagggggtatggatttgcagagccatacaatctctacagtaca
ctaaaagagttagtccttcattaccagcatacatcccttgtacaacataatgattctctc
aatgtcaggcttgcttatccagtctacgcacagatgccctccctctgcagataa

DBGET integrated database retrieval system