KEGG   Xenopus laevis (African clawed frog): 446878Help
Entry
446878            CDS       T01010                                 

Gene name
cyp2d6, cyp2d2, cyp2d6-a
Definition
cytochrome P450, family 2, subfamily D, polypeptide 6 (EC:1.14.14.1)
Orthology
K07414  
cytochrome P450, family 2, subfamily D [EC:1.14.14.1]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
Steroid hormone biosynthesis
Brite
KEGG Orthology (KO) [BR:xla00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    446878 (cyp2d6)
Enzymes [BR:xla01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     446878 (cyp2d6)
Cytochrome P450 [BR:xla00199]
 Cytochrome P450, animal type
  CYP2 family
   446878 (cyp2d6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
AA seq 505 aa AA seqDB search
MSLLSQLCSFAFGCNVFTLGIICTLCLLLLDYMKRKKPCKNFPPSPPSKPFVGNLLQLNF
RNLNNSFKQLSKQYGDVMSLQVFWKPVVVLNGLEVMKEALIQKSEDTADRPEFHVLEILG
FVGNNKAVVLANYGQSWKDLRRFTLSTLRDFGMGKKSLEERVREEAGYLCAAFQSEQGRP
FDPHILLNTAVSNVICSIIFGERFEYDDHTFQKLLCLIEESVKAESGAVPQIIASLPWSS
KIPGLAKMFFQPRIRMLKYLQEIIKDHQQTWDSGHTRDFIDAFMLEMEKAKGVKDSNFNE
QNLLLTTADLFSAGSETTNTTLRWGLLFMLLYPNVQRKVHEEIDHVIGRTRKPTMGDVLQ
MPYTNAVIHEIQRYVDIVPLSVPHMTYRDTHIQGFFIPKGVTIMTNLSSVLKDEKAWEKP
FQFYPEHFLDRDGKFVKREAFMAFSAGRRVCLGEQLARMELFLFFTTLLQRFSFQIPNGE
PSPREDPVFVFLQLPHDYKMCAKVR
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atgagccttttgtcccagctctgctcatttgcctttgggtgtaatgtcttcacactgggc
attatctgcaccctgtgtcttctgctgctggattacatgaagcgcaagaaaccctgcaaa
aatttcccacccagccctccttccaagccctttgtggggaatctactgcagttaaacttt
agaaacctaaacaacagcttcaaacagctctctaaacagtatggggatgtgatgagcctg
caggtcttttggaaacccgtggtggtgcttaatggattggaagtaatgaaagaggcttta
atacagaagtcagaggatacagcagatcgtccagaattccacgtgcttgaaatccttggg
tttgttggaaacaacaaagctgtggtgttagcaaattatggccaatcttggaaggattta
agaagatttaccttgtctacactgagggattttgggatgggaaaaaaatccctggaggag
agagtgagagaagaagctgggtacctgtgtgccgcgttccagtctgagcaaggtcgtccc
tttgacccacatattttactgaatacagcagttagtaacgttatctgctctatcatattt
ggtgaacggtttgaatatgacgatcacacattccagaagctgctgtgtctaattgaagaa
agtgtaaaagcagaatctggggcagtgcctcagattatagcttcacttccatggtcatct
aagattccaggtctggccaagatgtttttccaacctcggatacgtatgcttaaatatcta
caagaaattatcaaagatcatcagcaaacatgggattctgggcacacaagggattttatt
gatgcctttatgcttgagatggaaaaggcaaaaggagttaaagacagtaattttaatgaa
cagaatcttctgttaactacagctgacttattttcagctggctcagaaactacaaacaca
accctgagatggggcctgctatttatgttgctgtatccaaatgtgcaaagaaaggtgcat
gaggaaattgaccacgtgattggaagaaccaggaagccgacaatgggagatgtgttgcag
atgccttataccaatgcagtaatccatgaaatccagcgttatgtggatatagtccctctg
tctgtgccacatatgacatacagagacacacatatccaaggctttttcatcccaaaaggt
gtcactattatgaccaacctgtcctctgtgcttaaagatgagaaagcctgggaaaagcct
tttcagttttatccggagcattttcttgatagggacggcaagtttgtaaaaagagaagca
tttatggcattttctgcaggtcgccgtgtttgtttaggagagcagttggccaggatggaa
ctgttcctcttcttcacgactctcctgcagcgtttctcctttcagattcctaatggcgag
cctagcccacgggaagatcctgtgtttgttttcttgcagcttccacatgattataaaatg
tgtgccaaggttagataa

  All links  
No link information was found.   
DBGET integrated database retrieval system