KEGG   Xenopus laevis (African clawed frog): 446878Help
Entry
446878            CDS       T01010                                 

Gene name
cyp2d6.S, cyp2d2, cyp2d6, cyp2d6-a
Definition
(RefSeq) cytochrome P450 family 2 subfamily D member 6 S homeolog
  KO
K07414  cytochrome P450 family 2 subfamily D [EC:1.14.14.1]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla00140  Steroid hormone biosynthesis
Brite
KEGG Orthology (KO) [BR:xla00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    446878 (cyp2d6.S)
Enzymes [BR:xla01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     446878 (cyp2d6.S)
Cytochrome P450 [BR:xla00199]
 Cytochrome P450, animal type
  CYP2 family
   446878 (cyp2d6.S)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: p450 Glyco_hydro_66
Motif
Other DBs
NCBI-GeneID: 446878
NCBI-ProteinID: NP_001087043
Xenbase: XB-GENE-866630
UniProt: Q6DCR5
Position
4S
AA seq 505 aa AA seqDB search
MSLLSQLCSFAFGCNVFTLGIICTLCLLLLDYMKRKKPCKNFPPSPPSKPFVGNLLQLNF
RNLNNSFKQLSKQYGDVMSLQVFWKPVVVLNGLEVMKEALIQKSEDTADRPEFHVLEILG
FVGNNKAVVLANYGQSWKDLRRFTLSTLRDFGMGKKSLEERVREEAGYLCAAFQSEQGRP
FDPHILLNTAVSNVICSIIFGERFEYDDHTFQKLLCLIEESVKAESGAVPQIIASLPWSS
KIPGLAKMFFQPRIRMLKYLQEIIKDHQQTWDSGHTRDFIDAFMLEMEKAKGVKDSNFNE
QNLLLTTADLFSAGSETTNTTLRWGLLFMLLYPNVQRKVHEEIDHVIGRTRKPTMGDVLQ
MPYTNAVIHEIQRYVDIVPLSVPHMTYRDTHIQGFFIPKGVTIMTNLSSVLKDEKAWEKP
FQFYPEHFLDRDGKFVKREAFMAFSAGRRVCLGEQLARMELFLFFTTLLQRFSFQIPNGE
PSPREDPVFVFLQLPHDYKMCAKVR
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atgagccttttgtcccagctctgctcatttgcctttgggtgtaatgtcttcacactgggc
attatctgcaccctgtgtcttctgctgctggattacatgaagcgcaagaaaccctgcaaa
aatttcccacccagccctccttccaagccctttgtggggaatctactgcagttaaacttt
agaaacctaaacaacagcttcaaacagctctctaaacagtatggggatgtgatgagcctg
caggtcttttggaaacccgtggtggtgcttaatggattggaagtaatgaaagaggcttta
atacagaagtcagaggatacagcagatcgtccagaattccacgtgcttgaaatccttggg
tttgttggaaacaacaaagctgtggtgttagcaaattatggccaatcttggaaggattta
agaagatttaccttgtctacactgagggattttgggatgggaaaaaaatccctggaggag
agagtgagagaagaagctgggtacctgtgtgccgcgttccagtctgagcaaggtcgtccc
tttgacccacatattttactgaatacagcagttagtaacgttatctgctctatcatattt
ggtgaacggtttgaatatgacgatcacacattccagaagctgctgtgtctaattgaagaa
agtgtaaaagcagaatctggggcagtgcctcagattatagcttcacttccatggtcatct
aagattccaggtctggccaagatgtttttccaacctcggatacgtatgcttaaatatcta
caagaaattatcaaagatcatcagcaaacatgggattctgggcacacaagggattttatt
gatgcctttatgcttgagatggaaaaggcaaaaggagttaaagacagtaattttaatgaa
cagaatcttctgttaactacagctgacttattttcagctggctcagaaactacaaacaca
accctgagatggggcctgctatttatgttgctgtatccaaatgtgcaaagaaaggtgcat
gaggaaattgaccacgtgattggaagaaccaggaagccgacaatgggagatgtgttgcag
atgccttataccaatgcagtaatccatgaaatccagcgttatgtggatatagtccctctg
tctgtgccacatatgacatacagagacacacatatccaaggctttttcatcccaaaaggt
gtcactattatgaccaacctgtcctctgtgcttaaagatgagaaagcctgggaaaagcct
tttcagttttatccggagcattttcttgatagggacggcaagtttgtaaaaagagaagca
tttatggcattttctgcaggtcgccgtgtttgtttaggagagcagttggccaggatggaa
ctgttcctcttcttcacgactctcctgcagcgtttctcctttcagattcctaatggcgag
cctagcccacgggaagatcctgtgtttgttttcttgcagcttccacatgattataaaatg
tgtgccaaggttagataa

DBGET integrated database retrieval system