KEGG   Xenopus laevis (African clawed frog): 446982Help
Entry
446982            CDS       T01010                                 

Gene name
cdc16
Definition
cell division cycle 16
Orthology
K03353  
anaphase-promoting complex subunit 6
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
Cell cycle
Oocyte meiosis
Ubiquitin mediated proteolysis
Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:xla00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    446982 (cdc16)
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    446982 (cdc16)
   04114 Oocyte meiosis
    446982 (cdc16)
 Organismal Systems
  Endocrine system
   04914 Progesterone-mediated oocyte maturation
    446982 (cdc16)
Protein phosphatases and associated proteins [BR:xla01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     446982 (cdc16)
Ubiquitin system [BR:xla04121]
 Ubiquitin ligases (E3)
  multi subunit Ring-finger type E3
   APC/C
    other subunits
     446982 (cdc16)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
AA seq 621 aa AA seqDB search
MNLDRLRKRVRQYIEQQQYQSALFWADKVASLSHEEPQDIYWLAQCLYLTAQYHRASHAL
RSRKLDKVHEACRYLAARCHYAAKEYQQALDILDMEEPINKKLFEKSLKEDLKEPSGEWQ
MSQSSIKSSICLLRGKIYDALDNRTLATYSYKEALKFDVYCFEAFDLLTAHHMLTAQEEK
ELLDSLPLSKKCSEDQELLRFLYENKLKKYNKPSETLIPESADGLQENLDVVVSLAERHY
YNCDFKMCYKLTSVVMEKDPFHANCLPVHIGTLVELNKANELFYLSHKLVDLYPNNPVSW
FAVGCYYLMVGHKNEHARRYLSKATALERSYGPAWIAYGHSFAVESEHDQAMAAYFTAAQ
LMKGCHLPMLYIGLEYGLTNNSKLAERFFSQALSIAPEDPFVMHEVGVVAFQNGDWKTAE
KWFLDALEKIRVIGDEVTVDKWEPLLNNLGHVLRKLKKYDEALEYHRQALVLIPQNASTY
SAIGYIHSLMGNFESAIDYFHTALGLRRDDTFSVTMLGHCIEMYIGDSDAYIGTEIKDKL
RCYDFDVHTMKTLKNIISPPWEEREFDFERQSLDESGIMALETSNLLPKSSDTRSPIEEA
LEIEMNESDMMLETSMSDHST
NT seq 1866 nt NT seq  +upstreamnt  +downstreamnt
atgaacctggatcgtctgaggaagcgagtccggcagtacatagagcagcaacaataccaa
agtgcactcttttgggcagataaagttgcttcattgtcacatgaagagccacaggatatt
tattggctggcacaatgtctctacctaactgctcagtatcatagggcatctcatgcttta
aggtcacgcaaactggacaaagtacacgaggcatgcagatatcttgcagcacgttgtcat
tatgctgcaaaagagtaccagcaagctctggatatacttgatatggaagaaccaatcaac
aagaaattatttgagaagagtctgaaagaagatctgaaggagccatcaggagaatggcag
atgtcacagtcttctatcaaaagctccatttgccttttgcgagggaaaatctatgatgcc
ttagataacagaactttagcaacttacagctacaaagaagccttgaagtttgatgtttac
tgctttgaagcatttgacctcttaacagcccatcatatgttaacagcacaagaagaaaaa
gaacttcttgattctctacctcttagtaaaaagtgctcagaagatcaggaattgcttcgt
ttcctctatgagaacaaattaaaaaagtacaataagccaagtgagactctaattccggaa
tctgcagatggacttcaggaaaatcttgatgttgttgtatctttagcggaaagacattat
tacaactgtgactttaaaatgtgctacaaacttacttcagtggttatggaaaaagaccct
ttccatgcaaattgtttacctgttcatattggcactttagtagaactgaacaaagcaaat
gaacttttctatctttcccataaattagtggatttatatccaaacaatcctgtgtcctgg
tttgcagtgggttgttattatctcatggttggtcacaaaaatgaacatgcccggaggtat
ctcagcaaagcaactgcattagaacgaagctatggccctgcatggatagcatatggacat
tcatttgctgtagaaagtgaacatgaccaggctatggctgcatactttacagctgctcag
ctaatgaaagggtgccatttgccgatgctctatattggattagaatatggcttgaccaat
aactcaaaactagcagagcgattttttagccaagctttgagtattgctcctgaggaccca
tttgttatgcatgaagttggggttgtggcatttcaaaatggagactggaagactgctgag
aaatggttcttggatgctttagaaaaaatccgagtcattggagatgaggtaactgtggat
aaatgggagccactgcttaataatctgggtcatgtactaagaaaactgaagaagtatgat
gaagccttggagtatcatcggcaagctctggtgcttataccacaaaatgcttccacttac
tctgccattggatatatacacagcctaatgggaaattttgagagcgctatcgattatttt
cacactgcccttggtctcaggagagatgatacattttccgttacaatgcttggacactgc
atagaaatgtatattggtgactctgacgcctatattggaactgaaattaaagacaagtta
aggtgttatgactttgatgtccacacaatgaaaaccctgaaaaatataatttcacccccc
tgggaagaaagagaatttgattttgaacgtcagtcccttgatgaaagcggcattatggct
ttggagacttctaatcttctaccaaaatcctctgacaccagatccccaatagaagaagca
cttgaaattgaaatgaacgagagtgatatgatgctggaaacctccatgtctgatcacagc
acatga

DBGET integrated database retrieval system