KEGG   Xenopus laevis (African clawed frog): 447000Help
Entry
447000            CDS       T01010                                 

Gene name
bpnt1
Definition
3'(2'), 5'-bisphosphate nucleotidase 1 (EC:3.1.3.7)
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
Sulfur metabolism
Metabolic pathways
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:xla00920]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
AA seq 308 aa AA seqDB search
MASSPALLMKLVASAYSVAEKAGTIVRDVMSAGDLGIVEKTGANDLQTAADRLVQQSICA
SLAKKFPKLTIIGEEDLPSEEVEDNLLALGQSEEILKHSCPSQYSGIKEEEIVVWVDPLD
GTKEYTEGLLDHVTVLIGIAYEGKAIAGVINQPYYNYQAGNNAVLGRTIWGVLGIGAFGF
ELKEVPAGQHIITTTRSHSSKLVNDCIAAVNPDKVVRVGGAGNKVIQLIEGQASAYVFAS
PGCKKWDTCAPEAILHAVGGQLTDIHGNQFQYHKDVKHMNSAGVLAALRNFDYYFSRVPD
SVKQALVP
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atggcctcctctcccgctttactgatgaagttggtggcatctgcctattccgtagcagag
aaagctgggacgatagttagggacgtgatgagtgccggagatctgggtatagtagagaag
acaggagcaaatgacttgcagactgcagctgatcgcctggtgcaacagagtatatgtgcc
tccctcgcaaagaaattccccaaattgaccatcatcggagaggaggatctgccctctgag
gaagtggaagataacttgcttgcattggggcaatctgaggaaattctcaagcactcctgc
ccctctcagtacagtggcattaaagaagaagagattgtggtgtgggtggaccctctggat
ggaacaaaagaatacacagaaggtttgctggaccatgtgactgtgctgattggaattgca
tatgaaggaaaggccattgctggggtaataaaccagccatattataactatcaggctggt
aacaatgcagtgcttggaagaacaatctggggagttctgggcatcggtgcctttggcttt
gagctgaaagaagttcctgctgggcagcatatcatcaccaccactcgctctcacagcagc
aaactggtgaatgactgtatcgctgccgtcaaccctgataaggtggttcgagtgggtgga
gcaggaaataaggtcatacaacttattgagggacaagcatctgcctatgtgtttgcaagt
cccggctgtaagaaatgggacacctgtgctccagaggcgattctgcatgcggtaggaggc
cagctcactgatattcatggaaaccaattccaataccataaggatgtgaagcacatgaac
tcagccggggtgcttgctgctctgcgaaattttgactattacttctcccgtgtacctgat
tctgtgaaacaagctctggtgccttaa

DBGET integrated database retrieval system