KEGG   Xenopus laevis (African clawed frog): 447000Help
Entry
447000            CDS       T01010                                 

Gene name
bpnt1
Definition
3'(2'), 5'-bisphosphate nucleotidase 1 (EC:3.1.3.7)
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
Sulfur metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xla00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    447000 (bpnt1)
Enzymes [BR:xla01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     447000 (bpnt1)
Transfer RNA biogenesis [BR:xla03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    447000 (bpnt1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
AA seq 308 aa AA seqDB search
MASSPALLMKLVASAYSVAEKAGTIVRDVMSAGDLGIVEKTGANDLQTAADRLVQQSICA
SLAKKFPKLTIIGEEDLPSEEVEDNLLALGQSEEILKHSCPSQYSGIKEEEIVVWVDPLD
GTKEYTEGLLDHVTVLIGIAYEGKAIAGVINQPYYNYQAGNNAVLGRTIWGVLGIGAFGF
ELKEVPAGQHIITTTRSHSSKLVNDCIAAVNPDKVVRVGGAGNKVIQLIEGQASAYVFAS
PGCKKWDTCAPEAILHAVGGQLTDIHGNQFQYHKDVKHMNSAGVLAALRNFDYYFSRVPD
SVKQALVP
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atggcctcctctcccgctttactgatgaagttggtggcatctgcctattccgtagcagag
aaagctgggacgatagttagggacgtgatgagtgccggagatctgggtatagtagagaag
acaggagcaaatgacttgcagactgcagctgatcgcctggtgcaacagagtatatgtgcc
tccctcgcaaagaaattccccaaattgaccatcatcggagaggaggatctgccctctgag
gaagtggaagataacttgcttgcattggggcaatctgaggaaattctcaagcactcctgc
ccctctcagtacagtggcattaaagaagaagagattgtggtgtgggtggaccctctggat
ggaacaaaagaatacacagaaggtttgctggaccatgtgactgtgctgattggaattgca
tatgaaggaaaggccattgctggggtaataaaccagccatattataactatcaggctggt
aacaatgcagtgcttggaagaacaatctggggagttctgggcatcggtgcctttggcttt
gagctgaaagaagttcctgctgggcagcatatcatcaccaccactcgctctcacagcagc
aaactggtgaatgactgtatcgctgccgtcaaccctgataaggtggttcgagtgggtgga
gcaggaaataaggtcatacaacttattgagggacaagcatctgcctatgtgtttgcaagt
cccggctgtaagaaatgggacacctgtgctccagaggcgattctgcatgcggtaggaggc
cagctcactgatattcatggaaaccaattccaataccataaggatgtgaagcacatgaac
tcagccggggtgcttgctgctctgcgaaattttgactattacttctcccgtgtacctgat
tctgtgaaacaagctctggtgccttaa

DBGET integrated database retrieval system