KEGG   Xenopus laevis (African clawed frog): 447008Help
Entry
447008            CDS       T01010                                 

Gene name
rasgrp2-b, rasgrp2, xrasgrp2
Definition
RAS guanyl releasing protein 2 (calcium and DAG-regulated)
Orthology
K12361  
RAS guanyl-releasing protein 2
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
MAPK signaling pathway
Brite
KEGG Orthology (KO) [BR:xla00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    447008 (rasgrp2-b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
AA seq 594 aa AA seqDB search
MDSSDLDKGLTIDEIIAKCIQSFDKDGKLSDPKLVQMFLMMHPWYIPSGDLAKKLFALSE
SGDNVERERICQFVRFWISEFPAEFDLNPELGEQIRDLKRALENKGNRRESSLIDIESVP
SYGWKRQVTQRGPGGGRVRKTSLLFDHLDPAELAEHLTHLEFHSFSKILFQDYHSFVLHG
CTVGNPVLERFIALFNGVSQWIQLMVLSKHTPQQRAAVIKQFVQVAERLLQMQNFNTLMS
VVGGLSHSSISRLKDTQSHISPETTKVYDSLLELLTSSDNYARYRRRFATCKGFRFPALG
VHLKDLMALHVALPDWADKAKTIINISKMRQVYKVVHELTEAQRLEPPVKANPDLLNLLT
VSLDQYRSEEEIYQLSLQREPRARSTQTHAKSPPSPSPPLEEWASLKAKPDQALLCQHIE
KMVESVFRLFDEDGDGHISQEEFQSVRSNFPYLCAFNEIDQNQDGKISKQEMTSYFLRAS
SVLDCKMGFIHNFAERTFLRPVSCQHCRNLILGIYKKGLKCKACGITCHKHCRDHLSIEC
KKRSKSVSERGESMEKGRHFFFTLPRSFRRSTLYPDLREEEPHMEDDGVFDDHL
NT seq 1785 nt NT seq  +upstreamnt  +downstreamnt
atggattcatctgatcttgataagggtcttaccattgatgaaataatagcaaaatgcatc
cagagcttcgataaagatggaaagctatcagatcccaaacttgtccagatgtttttgatg
atgcatccttggtatataccatctggtgatcttgccaagaaactctttgctctatctgaa
tctggtgataatgtggaacgtgagaggatttgtcaatttgtgagattctggatatccgag
tttcctgcagagtttgatcttaacccagaacttggggagcaaatccgagacctgaagaga
gctctggagaacaaaggaaacagaagagaaagtagcctaatagacatcgagagtgtcccg
tcctatggatggaagcggcaggtgacacaacgtggccccggtggcggcagagttcggaag
acatccttgttgtttgaccacttagatccagctgaactagcagaacatttaacacacttg
gaatttcactcattctcaaagatcctgtttcaagactaccacagctttgttcttcatggt
tgtacagttggaaaccctgttttggaaaggttcatagcccttttcaatggggtgtctcag
tggatccagctgatggtgcttagtaaacatacccctcaacaaagagcagctgtgattaaa
cagtttgtacaggtggcagagaggctgctacagatgcagaattttaacactctaatgtct
gtggtggggggtctaagccacagttccatttcccggcttaaggacactcaatctcacatc
agtccagaaactaccaaggtgtatgattccctcttggagctcctgacctcttcagataac
tatgcaagatacaggcgcagatttgcaacatgtaaaggtttccgtttccctgcattggga
gtacacctgaaagacctcatggcactccatgtggctttgcctgattgggcagacaaagca
aaaaccatcattaacatctccaagatgcgtcaagtctacaaagttgttcatgagctcact
gaagcacagagattggagcctccagttaaagccaaccctgatttgctaaacttgttgacg
gtttctcttgaccagtatcgctcagaggaagaaatctatcagctgtctcttcaaagagaa
cctcgggcccgatctacacaaacacatgccaagtctccaccatctccttcacctccttta
gaagaatgggcatccctcaaagccaaaccagatcaagctctgctgtgccaacacatcgag
aaaatggtggagtccgttttcagattgtttgatgaagatggtgatggtcacatttctcag
gaagagttccaaagtgtccgtagcaattttccttatctgtgtgcctttaacgaaatagac
cagaatcaggatgggaagatcagtaaacaggagatgacttcatattttctgcgagctagc
tcagtgctggattgcaaaatgggatttatccacaattttgcagagaggacattcctgcga
cctgtgtcatgtcagcattgcagaaatctgatacttggaatctataagaaaggacttaaa
tgcaaagcctgtggaatcacttgccacaagcattgcagagaccatctttctatagagtgc
aagaagagatccaaaagtgttagtgagaggggtgagtcaatggagaagggccgccacttc
tttttcactcttccaaggtcctttagaagatcaacattgtatccagacttgagagaggaa
gaaccacatatggaggacgatggtgtttttgatgaccatttgtag

DBGET integrated database retrieval system