KEGG   Xenopus laevis (African clawed frog): 447035Help
Entry
447035            CDS       T01010                                 

Gene name
guk1.L, gmk, guk1
Definition
(RefSeq) guanylate kinase 1 L homeolog
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla00230  Purine metabolism
xla01100  Metabolic pathways
Module
xla_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:xla00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    447035 (guk1.L)
Enzymes [BR:xla01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     447035 (guk1.L)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Guanylate_kin AAA_16 AAA_18 ABC_tran AAA_33 MMR_HSR1 RsgA_GTPase AAA_22 RNA_helicase AAA_29 NACHT AAA AAA_24 dNK AAA_17 cobW AAA_23 Zeta_toxin AAA_28 AAA_14 AAA_30 AAA_21 NTPase_1 Cytidylate_kin TsaE
Motif
Other DBs
NCBI-GeneID: 447035
NCBI-ProteinID: NP_001087146
Xenbase: XB-GENE-6254574
UniProt: Q6AZF5
Position
6L
AA seq 198 aa AA seqDB search
MTGPRPVVLSGPSGAGKSTLLKMLMREFEGLFGFSVSHTTRKPRPGEVDGKDYHFVTLED
MKRGVERGDFIEHAVFSGNMYGTSTAAVQAVQANNQICILDIDMQGVKSIKKTRLNPIYI
SIHPPSVQILEQRLRDRNTESEESLQKRLNAAIEDLEISKEPGLFDAVIVNDDLEEAYNK
LKGILAKEIKQVQSGKNS
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgactgggcccagacctgttgtgctgagcggaccctccggtgcagggaaaagcaccctc
ctgaagatgctcatgagagaatttgaaggactgtttggcttttcagtttcacataccacg
agaaagccccggcctggggaagttgatgggaaagattaccactttgtgactctggaggac
atgaagaggggagtagagagaggggactttatagaacatgcagtgttttcgggcaacatg
tatgggaccagtacagccgccgtgcaggccgtccaggccaataatcagatctgtatactg
gacatcgacatgcagggagtgaagagcatcaagaagacccgtctgaatcccatttacatc
tccattcaccctccgtccgttcagatattagaacagcggttgcgagacagaaatacagag
tcggaggaaagtttacagaagagactgaacgcagccatcgaagacctggagatcagcaaa
gagccgggcctgtttgatgccgttattgttaatgatgatttagaggaggcatacaacaaa
ctgaaggggattctggcaaaagagatcaaacaagtccaaagcggcaagaattcctga

DBGET integrated database retrieval system