KEGG   Xenopus laevis (African clawed frog): 447035Help
Entry
447035            CDS       T01010                                 

Gene name
guk1, gmk
Definition
guanylate kinase 1 (EC:2.7.4.8)
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
Purine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xla00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    447035 (guk1)
Enzymes [BR:xla01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     447035 (guk1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
AA seq 198 aa AA seqDB search
MTGPRPVVLSGPSGAGKSTLLKMLMREFEGLFGFSVSHTTRKPRPGEVDGKDYHFVTLED
MKRGVERGDFIEHAVFSGNMYGTSTAAVQAVQANNQICILDIDMQGVKSIKKTRLNPIYI
SIHPPSVQILEQRLRDRNTESEESLQKRLNAAIEDLEISKEPGLFDAVIVNDDLEEAYNK
LKGILAKEIKQVQSGKNS
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgactgggcccagacctgttgtgctgagcggaccctccggtgcagggaaaagcaccctc
ctgaagatgctcatgagagaatttgaaggactgtttggcttttcagtttcacataccacg
agaaagccccggcctggggaagttgatgggaaagattaccactttgtgactctggaggac
atgaagaggggagtagagagaggggactttatagaacatgcagtgttttcgggcaacatg
tatgggaccagtacagccgccgtgcaggccgtccaggccaataatcagatctgtatactg
gacatcgacatgcagggagtgaagagcatcaagaagacccgtctgaatcccatttacatc
tccattcaccctccgtccgttcagatattagaacagcggttgcgagacagaaatacagag
tcggaggaaagtttacagaagagactgaacgcagccatcgaagacctggagatcagcaaa
gagccgggcctgtttgatgccgttattgttaatgatgatttagaggaggcatacaacaaa
ctgaaggggattctggcaaaagagatcaaacaagtccaaagcggcaagaattcctga

DBGET integrated database retrieval system