KEGG   Xenopus laevis (African clawed frog): 447178Help
Entry
447178            CDS       T01010                                 

Gene name
uros
Definition
uroporphyrinogen III synthase (EC:4.2.1.75)
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xla00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    447178 (uros)
Enzymes [BR:xla01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     447178 (uros)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
AA seq 262 aa AA seqDB search
MKVLLLKDPKTKDLASDPYVKELSSHGLQATLIPVLSFKFVSLDHFFDKLSHPESYAGLI
FTSPRAVEAVKLCLQKPAHKEAWKDHLCAKWNSKPVYVVGKATASLVEEIGLSSEGEGSG
NAEKLAECICSKGLSYSAPILFPCGSLKKEVLPKKLQEKNVPLETITVYQTGPHPAIQVS
LSDYFTKEGVPASIVFFSPSGLKYCLLFLKDLPSDQLNQIKFAAIGPTTAEAMAEEGIPV
SCTAQNPTPQDLAIGIKQIGMQ
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgaaggttttgttactgaaagaccccaaaactaaggatttggcttcagatccctatgtt
aaggaattatcatcgcatggattacaagcaacactaatccccgtgttatccttcaaattt
gtgtctctggatcatttttttgacaagctttctcacccagagagttacgccggtcttata
tttaccagcccaagagcagtagaagctgtcaaattatgtttgcaaaagcctgctcataaa
gaagcttggaaggaccatctctgtgccaagtggaattctaagcccgtttatgtggttggc
aaagctacagcttctttggttgaagaaattggtctttcgtcagaaggggaaggctcagga
aatgcagaaaagcttgcggaatgtatctgttcaaagggattatcgtattccgcacccatt
ctttttccttgtggatctttgaaaaaagaggttcttcctaaaaaactccaggagaaaaat
gtacctctggagaccattacggtttatcagactggcccgcatcccgctatacaagtttcg
ctctcggattatttcacaaaggaaggtgtcccagcaagtattgttttctttagtccgtct
gggctgaaatattgtctcttgtttcttaaggatctccctagcgatcagcttaatcaaata
aagtttgctgccattggtcctacaactgcggaagcaatggccgaagaaggcatcccagtc
tcctgcacggctcaaaaccccactccccaggacttagcaataggaataaaacaaattggc
atgcaatga

DBGET integrated database retrieval system