KEGG   Xenopus laevis (African clawed frog): 447208Help
Entry
447208            CDS       T01010                                 

Definition
(RefSeq) MGC81785 protein
  KO
K01367  
calpain-1 [EC:3.4.22.52]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
Protein processing in endoplasmic reticulum
Apoptosis
Necroptosis
Cellular senescence
Brite
KEGG Orthology (KO) [BR:xla00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    447208
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    447208
   04217 Necroptosis
    447208
   04218 Cellular senescence
    447208
Enzymes [BR:xla01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.52  calpain-1
     447208
Peptidases [BR:xla01002]
 Cysteine Peptidases
  Family C2: calpain family
   447208
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Xenbase: 
Position
4S
AA seq 713 aa AA seqDB search
MAEEVIVPVYATGISAQLQKQRDHELGVGKHENAVKFLGQDYDRIRHECLQNGSLFKDDT
FPPSAYSLGFKELGPNSSKTYGVKWVRPSQLVSSPQFIVDGATRTDICQGALGDCWLLAA
IASLTLNDTVLHRVVPHGQSFQDNYAGVFHFQLWQFGEWIDVVIDDYLPVKDGKLVFVHS
ASGNEFWSALLEKAYAKANGCYEALSGGSTSEGFEDFTGGVTEWYEMKKAPKDIFNIILK
ALERGSLMGCSIDITSATDMEAVTFKKLVKGHAYSVTGAKEINFRGQNTKLIRMRNPWGE
VEWTGAWSDGSSEWNSVDAADREELRIKMEDGEFWMAFQDFLREFSRLEICNLTPDALSA
RRYRKWNTTLYNGSWRKGSTAGGCRNYPATFWINPQFKIKLEEEDEDDDYGSEKGCTFLL
ALMQKNKRKERRVGKDMETIGFAVYEVPREFYGQSGVHLKRDFFLQNASSARSEQFINLR
EVSTRHKLRPGEYIVVPSTFEPNVEGDFVIRVFSENKHGSVEMDDPLSADLPPEEVLSET
EIDEGFKNLFKQLAGADLQISASELQSILNKIVSKHKDLRTSGFSLESCRSMVNLMDKDG
NGKLGLAEFNILWNKIKNYLTIFRKYDVDKSGSMSAYEMRLAVESAGFKLTNSLHQLIIT
RYSEPDMAMNFDSFTCCLIRLETMFRFFQGMDPQKQGVINFDLFSWLQMTMFA
NT seq 2142 nt NT seq  +upstreamnt  +downstreamnt
atggccgaggaagtgatcgtgccagtttacgccaccgggatttcggcgcagctgcagaag
caacgcgaccacgaactgggggtcgggaaacacgagaatgcggtgaaatttctgggacag
gattatgaccggattcgccacgagtgcctgcaaaacggaagcctctttaaggatgacact
ttcccaccgtcggcttattctctgggctttaaggagctcggcccaaactcatccaaaacc
tatggagtgaagtgggttcggccttcgcaactcgtctccagcccacagtttattgtcgat
ggtgccacaagaactgacatctgtcagggagcgttgggcgactgttggctcctcgctgct
attgcctccctcacattaaatgatacagtcctgcaccgggttgtacctcatggtcagagc
ttccaggataactatgccggagtctttcattttcagctgtggcagtttggcgagtggatt
gatgtggttatcgatgattacctccctgttaaagatggaaaactggtattcgtgcactcg
gcttctgggaatgaattctggagtgctttactggagaaggcctatgccaaggccaatggc
tgctatgaggctctctctggaggcagcacatcagaaggatttgaggattttactggaggg
gtaacagagtggtatgagatgaagaaagcacctaaagatatatttaacattattctgaag
gcgttggagagaggttccctcatgggctgttccattgatatcactagtgccacagatatg
gaggccgtaacattcaagaagcttgtcaaaggtcacgcatactctgttacaggggccaaa
gagatcaactttaggggtcagaacacaaagctgattcggatgagaaatccatggggtgag
gtggagtggacaggagcatggagtgatggttcatctgaatggaactcagtggatgcagca
gacagagaagagttgagaataaagatggaggatggagaattctggatggcttttcaggac
ttccttcgcgaattttctcgcctcgagatctgtaacctcacgccagatgcgctcagcgcc
cgcagataccgtaagtggaacacaacactctacaatgggtcttggaggaaaggcagcacg
gctggcggatgcagaaattaccctgccacattctggatcaacccacagttcaagatcaaa
ctggaggaggaggatgaggacgatgactacggctctgaaaaaggctgcaccttcctcctt
gcacttatgcaaaagaacaagcgcaaagagaggcgcgttgggaaagatatggagaccatt
ggatttgcagtctatgaggttcccagagagttttacggccagtcaggtgtgcacctaaag
cgggatttcttccttcaaaacgcctccagcgctcgctccgagcagttcatcaacctgcga
gaggtcagcacccggcacaaactgcgccccggagaatacattgtggtgccttctaccttt
gaacctaatgtggaaggagactttgtcatcagagtcttctctgaaaacaaacatggctct
gttgagatggatgatcctttatctgctgacctaccccctgaggaagttttgtctgagact
gaaatcgatgaagggttcaagaatcttttcaagcaactggctggtgctgatttgcaaatc
agtgcatcggagttacagtccattctaaataaaattgtatcaaagcataaagatcttcgc
acatcgggatttagtttggagtcgtgccgcagcatggtgaacctgatggataaagacggg
aatggaaaattaggactggcggagttcaatattctgtggaataaaattaagaattacttg
acaatattccggaagtatgacgtggataaatcgggaagtatgagcgcctatgagatgcgt
ctggcggtggagtctgcaggtttcaagttgaccaacagtctgcatcagctcatcatcacc
agatactcagagcctgatatggccatgaatttcgatagcttcacctgctgtctcatcaga
ctggagactatgttccgatttttccagggtatggacccacagaaacaaggagtgatcaat
tttgacctgtttagttggctccaaatgacaatgtttgcatag

DBGET integrated database retrieval system