KEGG   Xenopus laevis (African clawed frog): 447256Help
Entry
447256            CDS       T01010                                 

Gene name
usp5-b, isot, usp5
Definition
ubiquitin specific peptidase 5 (isopeptidase T)
Orthology
K11836  
ubiquitin carboxyl-terminal hydrolase 5/13 [EC:3.1.2.15]
Organism
xla  Xenopus laevis (African clawed frog)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
AA seq 855 aa AA seqDB search
MADVKDALLSVLPTIRVPRAGDRVHKDECAYSFHTPETDSGLYICMNTFLGFGRPYVEQQ
YNKTGQRAFLNIKRTPKMKSDESNSGTGDPPRKKPTRLAIGMEGGFDMTEEQCEYEEVLK
LVILPEFLEIPRDGLSGLPEMVRDRVSSAIDAILSADSASRKQEIQAWDGEVRQVSKHAF
NLQQLQGVPRIPPCGWKCSVCDLRENLWLNMTDGAIFCGRRYFDGSGGNNHALQHYQETG
FPLAVKLGTITPDGGDVYSYDEDDMVLDPNLAEHLSHFGIDMMKMQKTDKTMTELEIDMN
QRIGEWEVIQESGVQLQPLYGSGYTGIQNLGNSCYLNSTMQVIFSIPAFQRKYVERMEQI
YHKSPADPTQDFNTQVAKLGHGLLSGEYSKPALEKDSDIAPEHKGLQDGLAPRMFKALIG
KGHPEFSTNRQQDAQEFFLHFINMVERNCRSSSNPNEVFRFLVEEKIKCLVSQKVKYTQR
VEYMLQLPVPMEAALNKEELSAYEQCRLQAEREHRPPPELVRARIPFTSCLEAFAAPEQL
DEFWSAALQAKSNALKTSRFASFPDYLVIQIKKFTFGLDWVPKKLDVSIDVPDELDLSDF
RGGGLQGGEEELPDVAPPLVTPDEPKGSLGFYGLDDDDSYCSPHFSSPTSPVLDESVVTQ
LIEMGFPAEACRKAVYYTGNSGAEAAMTWVMSHMDDPDFALPMSGASAPLSASTGGDPPS
EEHVATIISMGFSQEQAVKALRATNNNLERAVDWIFSHIDDLDAEASMDLSEGRSAAESV
SESLPPAGPRVRDGAGRYELFAFISHMGTSTMCGHYVCHIKKEGRWVIYNDQKVCASEKP
PKDLGYIYFYQRIQS
NT seq 2568 nt NT seq  +upstreamnt  +downstreamnt
atggctgatgtgaaagatgctctgctgtctgtgctgccgaccattcgggtacctcgggct
ggggaccgtgtgcacaaggatgaatgtgcctattccttccacactccggaaacagacagc
gggttatatatttgcatgaacacatttctgggctttgggagaccctatgttgagcagcaa
tacaacaagactgggcagagagcctttctgaatatcaagagaactcctaaaatgaaatcc
gatgaatctaattctggcacaggagaccctccacgcaagaagccgactcgcttagccatt
ggaatggagggcggctttgacatgactgaggaacagtgtgagtatgaggaagtgctgaag
ctggtcattctgcccgagttcctagagatcccacgggatggactgtcggggctcccggag
atggtcagggatcgggtgtcgtctgctattgatgccatactgtctgctgactctgcctcc
cggaaacaggaaattcaggcgtgggatggggaagtgaggcaggtttccaaacatgcgttc
aatctccagcagcttcagggagttccccgtattccaccttgcggatggaagtgcagtgta
tgtgatctgcgggagaatctatggctcaatatgacagacggtgccatcttttgtggaaga
cgttactttgacggcagcggagggaataatcacgcgttacagcactaccaagaaacaggc
ttccctttagcagtgaaactaggcaccattacgcctgatggaggagatgtatattcctac
gatgaggatgatatggttctggaccctaacctggcagagcatctctcacactttggcatt
gatatgatgaagatgcagaagacggataagaccatgacagaactggaaattgatatgaac
caacgaatcggagaatgggaggtgattcaggaatcaggtgtacaattgcagcccctctat
ggttcggggtacacaggcatccagaacctcggaaacagctgctacctcaattcaaccatg
caagtcatcttcagcatcccggccttccaacgcaaatacgttgaacgtatggagcagatt
taccataagtctcctgccgatccaacgcaagacttcaacacccaagtagctaagcttgga
catggtctgttatctggggaatactcaaagccagctctagagaaagacagtgacatagct
ccagaacataagggtcttcaggatgggctcgctccaagaatgtttaaggcacttattggg
aagggacaccccgagttttccactaaccggcaacaagatgctcaggaattcttcctgcac
tttataaatatggttgagaggaactgccgcagctcatccaaccctaatgaagttttccgt
ttcctggtggaagagaagattaagtgtctggtgtctcagaaagtgaagtatacacagagg
gttgagtatatgctgcaacttcctgttcccatggaggctgcactcaataaggaggagctg
tctgcatatgagcaatgccgactccaggctgaacgtgagcatcgcccccctccagaacta
gtccgggcacgtattccatttacatcttgtttggaggcatttgctgcccccgagcagctc
gatgagttctggagcgccgctcttcaggccaaatccaatgcactcaagacttcccgattt
gcctcatttcctgattacttggtcattcaaatcaagaagttcacttttggccttgactgg
gtacctaagaaactggatgtctctattgatgtcccagatgaattggatctttctgatttt
cggggtggggggcttcaagggggggaagaggagctccctgatgttgcccccccattggtc
acacccgacgagcccaaaggtagccttggtttctatggcctcgacgatgacgactcgtac
tgctcccctcacttctcctctccgacatctccagtgctggacgagtcggtggttacgcag
ttgatagagatgggattcccagcagaggcgtgccggaaagctgtgtattacacgggcaac
agcggggcggaggctgctatgacatgggtgatgtcacacatggatgatccagattttgcc
ttgcctatgtctggagctagtgcacccttatcagctagtactggaggggatccaccatct
gaggaacatgtagcgacaataatatccatgggcttctcccaggagcaagcagtgaaagct
ctccgtgccactaacaacaacttggaacgcgctgttgactggatcttctctcacatcgat
gacttagacgctgaggcttccatggatttatctgagggtcgttctgctgcagagtctgtg
tctgaaagtctccctcctgcaggacctcgtgtgagggatggagctggcagatatgagctt
tttgccttcatcagtcacatgggcacatccaccatgtgcggtcattacgtgtgtcatata
aagaaggagggaaggtgggtgatctataatgaccagaaagtgtgtgcttcagagaagcct
cccaaagacctgggttacatttacttctaccaacgtatacagagttaa

DBGET integrated database retrieval system