KEGG   Xenopus laevis (African clawed frog): 447267Help
Entry
447267            CDS       T01010                                 

Gene name
cyp21a2.1, ca21h, cah1, cps1, cyp21, cyp21b, p450c21b
Definition
cytochrome P450, family 21, subfamily A, polypeptide 2, gene 1
Orthology
K00513  
steroid 21-monooxygenase [EC:1.14.99.10]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
Steroid hormone biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xla00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    447267 (cyp21a2.1)
Enzymes [BR:xla01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.10  steroid 21-monooxygenase
     447267 (cyp21a2.1)
Cytochrome P450 [BR:xla00199]
 Cytochrome P450, animal type
  CYP21 family
   447267 (cyp21a2.1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
AA seq 370 aa AA seqDB search
MRNDLEKVLIREARLLCQDCLDLNGEPVDISRSFSLRTCRIIAELTFGTTYDFTDPDFQK
IHKCIIDIIKLWESPSVTALDFIPFLQKFPNQTLNLLLETAKQRDSFIKSQVEAHKAHLP
SSKYNEDILDGMIRLIREKSGDDSNGMSEFSEDHLHMAVVDLFIGGTETTASLLTWTVAY
LMHYPEAQERIHQEITGAVGTERYPTYTDRNRMPYLNATISEMLRLRPVVPLAVPHCTIK
DTSIAGYTIPKGTTVIPNIYAAHLDETIWDNAAQFCPDRFLSPSESSNSARALLPFSVGA
RLCIGETLARMEVFFFLSHLLRDYRLLSPSPKLLPQLSGMFGINLKCHPFMVCISPRENT
PKILDFNKET
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atgcgcaatgacctagagaaagtgctcatccgagaagctaggttactgtgccaggattgt
ctggacctgaatggggaaccagtggatatatctagatcattttctctaagaacctgcagg
atcatagcagaactgacatttggcaccacgtatgattttacagaccccgatttccagaag
attcacaaatgcattattgatatcattaagttatgggagtcaccaagtgtcactgctctg
gattttataccatttctgcagaagttcccgaatcaaaccttaaaccttctgctggagact
gcaaagcaaagagattcctttataaagagccaagtagaagcccacaaggcacatctccca
tccagtaaatataatgaagacattttagatggaatgattcgcttaattcgagaaaaatct
ggagatgacagcaacggaatgtcagaattttctgaagatcatcttcatatggctgttgtt
gatctctttataggagggacagaaaccaccgcatccttattaacctggacagtggcctac
ctcatgcattacccagaagcacaagagagaattcaccaggaaatcacaggagcagtgggt
acagagagatacccaacatatacagaccgtaacagaatgccctaccttaatgccactatt
tctgagatgctcagacttcgacctgtggttcccctagctgtgccacactgtactattaag
gatacaagcattgcaggatataccatccctaagggcaccactgtaatcccaaatatttat
gctgctcaccttgatgagacaatatgggacaatgctgcacagttctgtccagatcgcttc
ctctccccatcagaaagctcaaattctgcccgcgctctccttccattcagtgtgggtgca
aggctttgtattggtgagaccttggcacgaatggaggtctttttcttcttgtctcacctc
ctgagggattatcgcctcctgtccccttcacctaaacttttgcctcaactcagtgggatg
tttggaatcaacctcaagtgccacccatttatggtctgtatatcaccccgagaaaacaca
cccaaaatactggattttaataaggaaacatga

DBGET integrated database retrieval system