KEGG   Xenopus laevis (African clawed frog): 447268Help
Entry
447268            CDS       T01010                                 

Gene name
B-Raf
Definition
(RefSeq) MGC86346 protein
  KO
K04365  
B-Raf proto-oncogene serine/threonine-protein kinase [EC:2.7.11.1]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
MAPK signaling pathway
ErbB signaling pathway
FoxO signaling pathway
mTOR signaling pathway
Vascular smooth muscle contraction
Dorso-ventral axis formation
Focal adhesion
Regulation of actin cytoskeleton
Insulin signaling pathway
Progesterone-mediated oocyte maturation
Module
MAPK (ERK1/2) signaling
Brite
KEGG Orthology (KO) [BR:xla00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    447268 (B-Raf)
   04012 ErbB signaling pathway
    447268 (B-Raf)
   04068 FoxO signaling pathway
    447268 (B-Raf)
   04150 mTOR signaling pathway
    447268 (B-Raf)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    447268 (B-Raf)
  Cellular community
   04510 Focal adhesion
    447268 (B-Raf)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    447268 (B-Raf)
   04914 Progesterone-mediated oocyte maturation
    447268 (B-Raf)
  Circulatory system
   04270 Vascular smooth muscle contraction
    447268 (B-Raf)
  Development
   04320 Dorso-ventral axis formation
    447268 (B-Raf)
Enzymes [BR:xla01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     447268 (B-Raf)
Protein kinases [BR:xla01001]
 Serine/threonine protein kinases: TKL group
  RAF family [OT]
   447268 (B-Raf)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
AA seq 802 aa AA seqDB search
MAALSGGSAEGPSLLNGDLLESETGGLGGAGEMSVSGGYPEEVWNIKQMIKLTQEHIEAL
LDKFGGEHNPPSIYLEAYEEYTSKLDLLQQREQQLLESMGNGSDSSSLSSELTISSVPSN
LSLAPSTLSALHTPSDPSRINPRSPQKPIVRVFLPNKQRTVVPARSGVTVRDSLKKALMM
RGLIPECCAVYRVQDGEKKPIGWDTDISWITGEELHVEVLENVPLTTHNFVRKTFFTLAF
CDFCRKLLFQGFRCQTCGYKFHQRCSTEVPLMCVNYDRLDLLFVSKFFEHHPISQEEAPF
EEFVPAVESLTPPPPPDATGPPSLPSASPSKSIPIPQPFRPDEDHRNQFGQRDRSSSAPN
VHINTIEPVNIDDLIQDPGLQRIEGAPSVQPTRCHRKYHSRDPSPLLHTLPSEIVFDFES
DPVCRGSTPGLSATPPASLPGSLANVKALQKSPGQQRERKSSSSSMEDRSRMKTLGRRDS
SDDWEIPDGQITVGQRIGSGSFGTVYKGKWHGDVAVKILNVTAPTPQQLQAFKNEVGVLR
KTRHVNILLFMGYSTKPQLAIVTQWCEGSSLYHHLHIIETKFEMIKLIDIARQTAQGMDY
LHAKSIIHRDLKSNNIFLHEDLTVKIGDFGLATVKSRWSGSHQFEQLSGSILWMAPEVIR
MQDNNPYSFQSDVYAFGIVLYELMTGQLPYSNINNRDQIIFMVGRGYLSPDFSKVRSNCP
KAMKRLIADCLKKKRDERPLFPQILASIELLARSLPKIHRSASEPSLNRAGFQTEDFSLY
TCASPKTPIQGGAYGGFVIGAL
NT seq 2409 nt NT seq  +upstreamnt  +downstreamnt
atggcggcgctaagtgggggatcagcagaggggccctcgttgcttaacggggacctgctg
gagtccgagaccgggggactgggcggagccggcgagatgtctgtgtccggggggtatccg
gaagaggtctggaatatcaaacaaatgataaagttaacacaagagcacatagaagccctg
ttggacaagtttggaggcgagcacaaccccccatcaatatatctagaggcctatgaagaa
tataccagcaaactggatctattgcagcagagggagcagcagttactggagtctatgggc
aatggaagcgactcctcttctttgtcttcagagctgacgatttcctcagtcccgtcgaat
ctatccttggcaccttcaactctctcagccctgcacaccccctctgatccctcccgcatc
aaccccagatctccccagaaaccgatcgttcgagtcttccttcccaacaagcagcgcact
gtggtaccagcaaggagtggtgtgacagtgcgagacagcttaaagaaagccctgatgatg
cgaggcttgatcccagaatgctgtgctgtctacagggtgcaggatggggagaagaagccg
attggctgggacacagatataagctggatcaccggagaagagttacacgtggaagtcttg
gagaatgtgccactcacaacccataactttgtacggaaaaccttcttcacactcgctttc
tgtgacttctgccggaagctgctattccagggctttcgctgccagacgtgtgggtacaag
ttccaccagcgctgcagcacggaggtgcctctcatgtgtgttaactacgaccgcctagat
ttgctgtttgtctccaagttctttgagcaccacccgatatctcaggaggaagctcctttt
gaagagtttgtcccagccgttgagtcgttgactcctccgccccctccagatgccacaggc
cctcccagtctaccaagtgcttctccttctaagtccatcccgataccccagccgttccga
cccgacgaggaccaccggaaccagtttggccagcgggatcgatcgtcctcggcgccgaac
gtgcacataaacaccatcgaaccggtcaatatagatgacttgattcaagacccgggtctc
cagcgcatcgagggagccccctcagtccagccgacgcgctgccatcggaaataccattca
cgggatcccagcccactccttcatactctccccagtgaaatagtctttgattttgaatct
gatcccgtttgcagaggttcaactcctggcttatcggcgaccccacctgcctccctcccc
ggctccctcgccaacgtcaaggccctacagaaatccccaggccagcaaagagagcgcaag
tcctcctcgtcctcaatggaagacaggagtcgaatgaaaacgcttggacgtcgcgactcc
agtgacgactgggagattcctgatgggcaaatcacagttgggcagagaataggttctgga
tcttttgggacagtatataagggaaagtggcatggggacgtagcggtgaaaatattgaat
gtaacggctccaacgcctcagcagctacaggcctttaaaaatgaagttggagtcctccga
aaaacacgacacgtgaacatcctgcttttcatgggctactccacgaagccccaactggca
atagtgacccagtggtgcgagggctccagtctctatcaccatctgcacatcatcgagacc
aaatttgagatgattaaacttatcgacattgcacggcagacggcacagggcatggactat
ttgcacgcaaagtccatcattcacagagacctgaagagcaataatatattccttcatgaa
gacctcacggtgaagatcggtgactttggtttggcgacggtgaagtcccggtggagtggc
tctcatcagtttgagcagttatccggctccattctgtggatggctccggaggtcattcgg
atgcaagataacaacccgtacagctttcagtccgacgtctacgcctttggcattgttctg
tacgaattaatgacagggcagttgccctactcgaatatcaacaacagagaccagatcata
tttatggtcggcagaggctacttatctccagacttcagcaaagttaggagtaattgtccc
aaagcaatgaagcggttaatagcagactgcctgaagaagaagagagatgaacggccccta
ttcccacagattctcgcctccattgaactgctggcccggtcattgccaaaaatccaccgc
agtgcgtctgagccgtccttgaaccgggccggattccagacagaagacttcagtctgtac
acgtgtgcttctcccaaaactcctatccagggcggagcttatggtgggtttgttatcgga
gccctgtga

DBGET integrated database retrieval system