KEGG   Xenopus laevis (African clawed frog): 447268Help
Entry
447268            CDS       T01010                                 

Gene name
B-Raf
Definition
MGC86346 protein
Orthology
K04365  
B-Raf proto-oncogene serine/threonine-protein kinase [EC:2.7.11.1]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
MAPK signaling pathway
ErbB signaling pathway
FoxO signaling pathway
mTOR signaling pathway
Vascular smooth muscle contraction
Focal adhesion
Regulation of actin cytoskeleton
Insulin signaling pathway
Progesterone-mediated oocyte maturation
Module
MAPK (ERK1/2) signaling
Brite
KEGG Orthology (KO) [BR:xla00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    447268 (B-Raf)
   04012 ErbB signaling pathway
    447268 (B-Raf)
   04068 FoxO signaling pathway
    447268 (B-Raf)
   04150 mTOR signaling pathway
    447268 (B-Raf)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    447268 (B-Raf)
  Cellular commiunity
   04510 Focal adhesion
    447268 (B-Raf)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    447268 (B-Raf)
   04914 Progesterone-mediated oocyte maturation
    447268 (B-Raf)
  Circulatory system
   04270 Vascular smooth muscle contraction
    447268 (B-Raf)
Enzymes [BR:xla01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     447268 (B-Raf)
Protein kinases [BR:xla01001]
 Serine/threonine protein kinases: TKL group
  RAF family [OT]
   447268 (B-Raf)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 802 aa AA seqDB search
MAALSGGSAEGPSLLNGDLLESETGGLGGAGEMSVSGGYPEEVWNIKQMIKLTQEHIEAL
LDKFGGEHNPPSIYLEAYEEYTSKLDLLQQREQQLLESMGNGSDSSSLSSELTISSVPSN
LSLAPSTLSALHTPSDPSRINPRSPQKPIVRVFLPNKQRTVVPARSGVTVRDSLKKALMM
RGLIPECCAVYRVQDGEKKPIGWDTDISWITGEELHVEVLENVPLTTHNFVRKTFFTLAF
CDFCRKLLFQGFRCQTCGYKFHQRCSTEVPLMCVNYDRLDLLFVSKFFEHHPISQEEAPF
EEFVPAVESLTPPPPPDATGPPSLPSASPSKSIPIPQPFRPDEDHRNQFGQRDRSSSAPN
VHINTIEPVNIDDLIQDPGLQRIEGAPSVQPTRCHRKYHSRDPSPLLHTLPSEIVFDFES
DPVCRGSTPGLSATPPASLPGSLANVKALQKSPGQQRERKSSSSSMEDRSRMKTLGRRDS
SDDWEIPDGQITVGQRIGSGSFGTVYKGKWHGDVAVKILNVTAPTPQQLQAFKNEVGVLR
KTRHVNILLFMGYSTKPQLAIVTQWCEGSSLYHHLHIIETKFEMIKLIDIARQTAQGMDY
LHAKSIIHRDLKSNNIFLHEDLTVKIGDFGLATVKSRWSGSHQFEQLSGSILWMAPEVIR
MQDNNPYSFQSDVYAFGIVLYELMTGQLPYSNINNRDQIIFMVGRGYLSPDFSKVRSNCP
KAMKRLIADCLKKKRDERPLFPQILASIELLARSLPKIHRSASEPSLNRAGFQTEDFSLY
TCASPKTPIQGGAYGGFVIGAL
NT seq 2409 nt NT seq  +upstreamnt  +downstreamnt
atggcggcgctaagtgggggatcagcagaggggccctcgttgcttaacggggacctgctg
gagtccgagaccgggggactgggcggagccggcgagatgtctgtgtccggggggtatccg
gaagaggtctggaatatcaaacaaatgataaagttaacacaagagcacatagaagccctg
ttggacaagtttggaggcgagcacaaccccccatcaatatatctagaggcctatgaagaa
tataccagcaaactggatctattgcagcagagggagcagcagttactggagtctatgggc
aatggaagcgactcctcttctttgtcttcagagctgacgatttcctcagtcccgtcgaat
ctatccttggcaccttcaactctctcagccctgcacaccccctctgatccctcccgcatc
aaccccagatctccccagaaaccgatcgttcgagtcttccttcccaacaagcagcgcact
gtggtaccagcaaggagtggtgtgacagtgcgagacagcttaaagaaagccctgatgatg
cgaggcttgatcccagaatgctgtgctgtctacagggtgcaggatggggagaagaagccg
attggctgggacacagatataagctggatcaccggagaagagttacacgtggaagtcttg
gagaatgtgccactcacaacccataactttgtacggaaaaccttcttcacactcgctttc
tgtgacttctgccggaagctgctattccagggctttcgctgccagacgtgtgggtacaag
ttccaccagcgctgcagcacggaggtgcctctcatgtgtgttaactacgaccgcctagat
ttgctgtttgtctccaagttctttgagcaccacccgatatctcaggaggaagctcctttt
gaagagtttgtcccagccgttgagtcgttgactcctccgccccctccagatgccacaggc
cctcccagtctaccaagtgcttctccttctaagtccatcccgataccccagccgttccga
cccgacgaggaccaccggaaccagtttggccagcgggatcgatcgtcctcggcgccgaac
gtgcacataaacaccatcgaaccggtcaatatagatgacttgattcaagacccgggtctc
cagcgcatcgagggagccccctcagtccagccgacgcgctgccatcggaaataccattca
cgggatcccagcccactccttcatactctccccagtgaaatagtctttgattttgaatct
gatcccgtttgcagaggttcaactcctggcttatcggcgaccccacctgcctccctcccc
ggctccctcgccaacgtcaaggccctacagaaatccccaggccagcaaagagagcgcaag
tcctcctcgtcctcaatggaagacaggagtcgaatgaaaacgcttggacgtcgcgactcc
agtgacgactgggagattcctgatgggcaaatcacagttgggcagagaataggttctgga
tcttttgggacagtatataagggaaagtggcatggggacgtagcggtgaaaatattgaat
gtaacggctccaacgcctcagcagctacaggcctttaaaaatgaagttggagtcctccga
aaaacacgacacgtgaacatcctgcttttcatgggctactccacgaagccccaactggca
atagtgacccagtggtgcgagggctccagtctctatcaccatctgcacatcatcgagacc
aaatttgagatgattaaacttatcgacattgcacggcagacggcacagggcatggactat
ttgcacgcaaagtccatcattcacagagacctgaagagcaataatatattccttcatgaa
gacctcacggtgaagatcggtgactttggtttggcgacggtgaagtcccggtggagtggc
tctcatcagtttgagcagttatccggctccattctgtggatggctccggaggtcattcgg
atgcaagataacaacccgtacagctttcagtccgacgtctacgcctttggcattgttctg
tacgaattaatgacagggcagttgccctactcgaatatcaacaacagagaccagatcata
tttatggtcggcagaggctacttatctccagacttcagcaaagttaggagtaattgtccc
aaagcaatgaagcggttaatagcagactgcctgaagaagaagagagatgaacggccccta
ttcccacagattctcgcctccattgaactgctggcccggtcattgccaaaaatccaccgc
agtgcgtctgagccgtccttgaaccgggccggattccagacagaagacttcagtctgtac
acgtgtgcttctcccaaaactcctatccagggcggagcttatggtgggtttgttatcgga
gccctgtga

DBGET integrated database retrieval system