KEGG   Xenopus laevis (African clawed frog): 447465Help
Entry
447465            CDS       T01010                                 

Gene name
usp1, usp1-a
Definition
ubiquitin specific peptidase 1 (EC:3.1.2.15)
Orthology
K11832  
ubiquitin carboxyl-terminal hydrolase 1 [EC:3.1.2.15]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
Fanconi anemia pathway
Brite
KEGG Orthology (KO) [BR:xla00001]
 Genetic Information Processing
  Replication and repair
   03460 Fanconi anemia pathway
    447465 (usp1)
Enzymes [BR:xla01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     447465 (usp1)
Peptidases [BR:xla01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   447465 (usp1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
AA seq 766 aa AA seqDB search
MPGVTHCESQTVLSESSPPKRNRLSLRFFQKKDTKRALEFTEASPAAESQNDEEKESEIC
SDQVVPTPQLSPPACCVKKEGLIPFVGLNNLGNTCYLNSILQVLCYCPGFKSGIKFLSEI
ISKKAENISKEREQTQDKDTVKHELPASYDVICSLSSLVHSMEHLQITFLSNPENYDSEL
AAQPRRLLNTLREVNPMYEGYLQHDAQEVLQCILGNIQEACQIMKKEIQKNSQMNNFSSN
VQDTAKSTAECNGLNGGDPEAVNGSSAEITNENGKRKSDNDAGNVKKRTKLTKEPSAEEQ
RLTRSKRKSLSDTKQDKSTVAPPKTDSANSNHSQKKSKLRLTWLKSSKQPSILSKFCSLS
KQSDSSSKCSETRTHSIKTKDKTSESEQSKENGETTKTVSGNESSGFELVEKMFQGELVL
RTRCLECESFTERREDFQDISVPVLESEPPKLEDSSDLSPDPRLETKTLKWAISQFASVE
RIVGEDKYFCEKCHHYTEAERSLLFDKIPDIVTIHLKCFSANSSEFDCFGGLSKVNTALL
TPLDLSLEEWSTNQSKDLYRLFAVVMHSGVTISSGHYTAYVRIPEMSDLERDHIKTLVDH
KDVLKAEPLNEDEARMSDANYDDGEVSFRVNGCIPSASKVSKKQTETVSLLGGQKSKPDF
QQLPNKSAKSETVLNSLGDESYSASFSVDLQCELSEERNLSASSYTCKSANSTSSFLESL
KEYLGKWLLFDDSEVKVTEEKDFMTAISPNTLSTSTPYLLFYKKLV
NT seq 2301 nt NT seq  +upstreamnt  +downstreamnt
atgccaggagtcactcactgtgaaagccaaacagtcctatctgaaagcagtcctccaaaa
aggaaccgcttatccttgcgcttttttcagaagaaagacactaagagggcactggaattt
actgaggcttcaccagcagcagaaagccaaaatgatgaggaaaaggaatcagaaatctgc
agtgatcaagttgttccaactcctcagttatcaccaccagcttgctgtgtaaaaaaagaa
ggtcttattccatttgttggcttgaataatcttggtaatacctgctacctcaacagcata
cttcaggtattgtgctattgtcctggatttaaaagtgggatcaagtttctgtctgagatc
atttctaagaaggcagaaaatataagcaaagagagagagcagactcaagacaaggacact
gtaaagcatgagttacctgcaagttatgatgtcatctgcagtttaagttctttggttcac
tctatggaacaccttcaaataacttttctatcaaacccagaaaattatgattctgaactt
gcagcccaaccaaggaggcttcttaacacattgagggaggtaaatcctatgtatgaaggt
tatcttcagcatgatgcacaagaagttttgcagtgtattttgggaaatattcaagaggca
tgtcaaattatgaaaaaggaaatacagaaaaactcacagatgaataatttcagtagcaat
gtgcaggacactgctaaatcaacagctgagtgcaatgggttaaatggtggtgaccctgag
gctgtaaatggcagctctgctgaaataacaaatgaaaatggcaaaagaaaaagtgataat
gatgctgggaatgtaaaaaaaaggaccaaattaaccaaagagccatcagcagaagaacag
agactaaccagatcaaaaaggaagtccctatcagatacaaaacaagataaaagtacagtt
gctccacctaagactgacagtgcaaattcaaaccattcacagaaaaaatcaaagctaagg
ttaacctggctgaaatctagtaaacaacctagcatattatctaaattttgtagcttgagt
aaacagtcagactcttcatctaaatgctctgaaactagaacacacagcataaaaaccaaa
gataaaacatctgaaagtgaacagtctaaagaaaatggcgaaactacaaaaactgtttca
ggaaatgaatcaagtggttttgaattggtggaaaaaatgttccaaggagagctggtgttg
cgaacccgctgtcttgaatgtgagtctttcacagagaggagggaagattttcaagatatc
agtgtgcctgttctagaaagcgaaccaccaaaactggaggactcttctgacctttctcct
gatccccgacttgaaacaaagactttaaaatgggcaatttcccagtttgcatcagtagag
agaattgtcggagaggacaaatatttctgtgaaaagtgtcatcattacaccgaagctgaa
agaagtcttctttttgacaaaatcccagacatcgtgacaattcatctaaaatgcttttct
gcaaatagctctgaatttgattgctttggtggtctttccaaagtaaacactgcattgttg
actccgctggatttgtctcttgaggaatggagtacaaatcaaagcaaggacctttatcgg
ctatttgcagtggtaatgcacagtggggttactataagcagtggccactataccgcttat
gttcgaattccagaaatgagtgatcttgaaagagaccatataaaaactcttgttgaccac
aaggatgttctaaaggctgagccattaaatgaagacgaggcacggatgagcgatgccaat
tatgatgatggagaggtctcgtttagagtgaatggttgtataccatcagccagcaaagtg
agcaaaaagcaaaccgaaactgtaagccttttaggaggacaaaaaagtaaaccagacttt
cagcagttaccaaacaagtctgctaaatcggaaactgtcttaaactcccttggggatgaa
agttacagtgcaagctttagtgtagaccttcagtgtgagctatcggaagagaggaacttg
agtgcatcctcatatacctgcaaatctgccaactcaacttcttcctttttggaaagcctg
aaagagtatttaggaaaatggcttctttttgacgattcagaagtaaaagttacagaagaa
aaagatttcatgactgctatttccccaaacaccctttcaacatccactccttatttgctc
ttctataagaaattagtttaa

DBGET integrated database retrieval system