KEGG   Xenopus laevis (African clawed frog): 447469Help
Entry
447469            CDS       T01010                                 

Gene name
usp38
Definition
ubiquitin specific peptidase 38 (EC:3.1.2.15)
Orthology
K11854  
ubiquitin carboxyl-terminal hydrolase 35/38 [EC:3.1.2.15]
Organism
xla  Xenopus laevis (African clawed frog)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
AA seq 1037 aa AA seqDB search
MDKILEGLVTSSHPLNLKKVVVKKVVESAENSVSEEQCKAMFSLTTRLILEGQDPFQKQV
GHQVLEAYARYHRSEFENYFNRNFVLSLLQEGYRALERKDVAILDYIHNGLKLIMSCPSI
LDIFSVLQVEVLRIVCERPEPSVAARLSELLTDFVQCIPKGKMSIAFCQQLVRTIGHFQC
ISTYEKKLREYVSQVTKVSSLLQNIWKVEPCTLLPSLQEVFAIISSTDASFEPSVSLASL
VQHIPLQLITVLIRSLTTDPNVKDASMTQALCRMIDWLSWPLAQHVETWVIALLKGLAAV
QKFTILIDVTLQKIELVFHRLWFPLVRPGALAVLSHMLLSFQHSPEAFHMVVPHVVSLVQ
SFKNVGHPTSTTFLAEFAELMHCMIYHYSGFPDLYEPILEALKDLLKPSEEKMKLTLNQS
AWTSQSSTLASLPRLSGKSETGKTGLINLGNTCYMNSVLQALFMATDFRRQVLSLNLNGT
HSLMKKLQHLFAFLAHTQREAYAPQIFFDASRPPWFTPRSQQDCSEYLRFLLDRLDEEEK
TIKALCSKLPSDAPVTDCSVVESSASVSDDISNHYCTKESKGCGNKEKTLIEHMFGGKLQ
TNICCLNCRSTSQKREAFTDLSLAFCPTLVDKPVQSTLDSPKQKDDDCIEIDITPSVEAP
SILAPSTEDVTVRPAKDKSEYEVKMNDNCVLDNSECANAVESDNMSAQNNRREKTISVTD
LLNYFLAPEILDGDNQYYCEKCASLQNAEKTMQIMEEPEYLILTLLRFSYDPKCHVRRKI
TDNVSIPLVLDLPIERTTSSTSPADWAIETNVPDVTENLAKKLKPSNTEDLCCTRLVPYV
LSSVVVHSGTSSESGHYYSYARNVTSSERCLYAEKSCYSHGQLVGRETGSSVMTHNDAQC
NDISKDWFLFNDSRVTFTSFQSVFNITSRFPKDTAYVLIYRKHNLGDLNRIQSSSANGLW
VNGEPPLQKELLDAITKDNLLYLQEQELNARTRALQNTSASCSFRPNGFDDNDPPGSCGP
SGGGGDGGFSTLGRLVF
NT seq 3114 nt NT seq  +upstreamnt  +downstreamnt
atggataagattctggaaggattggtgacctcttcgcatcccttaaatctgaaaaaagtc
gtagtaaagaaagttgtggaatcggctgaaaattcagtcagtgaagaacaatgcaaggcc
atgttcagcctgactacccgcttaatcctggaaggacaggatccctttcagaagcaagtt
ggacaccaggtgttggaagcatatgccagataccatcggtcagaatttgagaattatttc
aacaggaactttgttttgagccttttgcaggaaggatacagagcattagagcgcaaggat
gttgctatattagactatatccataacgggctgaaactgattatgagctgcccctccata
ctagatatattttcagtcctacaggtagaagtgctgagaatagtctgtgaaagaccagag
ccatcagtagctgcaaggttaagcgaactgctcactgactttgtgcagtgcattcccaag
gggaaaatgtccattgcattttgccagcaactcgtaaggacaattggacattttcagtgt
atatcaacctatgaaaagaagctgcgcgaatatgtttctcaagttaccaaagttagtagt
ttgcttcaaaatatctggaaggttgagccatgcactttgcttccatcgctacaagaggtt
tttgcaattatttcttccacagatgcttcatttgagccgtctgtttctctagccagcctt
gttcagcacattcccttacagctgatcactgtcctcatcaggagtttaaccactgacccc
aacgtgaaagatgcaagtatgactcaggctctctgcaggatgattgactggttatcctgg
cctcttgctcaacatgtcgagacctgggtgatcgctctgctaaaagggctagcagctgta
cagaaatttactatccttatagatgtcactttacagaaaattgaactggtatttcacaga
ctgtggtttcccctggtaaggcctggtgctttggctgtcctctcccacatgttgctcagc
tttcaacattctcctgaggctttccatatggttgttcctcatgttgtgagtctggtccag
tcctttaagaatgttggtcacccaacaagtacaacgttcctagctgagtttgcagagctg
atgcactgcatgatttaccattattctggatttccagacctttatgagcctattttggaa
gcacttaaggatctgctgaaaccatctgaagaaaaaatgaaacttaccctaaatcaaagt
gcatggacttctcaatcaagtactttggcatctttacccagattgtcgggaaaatcagaa
actgggaaaactgggctcattaacctggggaacacgtgttacatgaacagcgttttacag
gccctctttatggctaccgattttaggaggcaagtgttatcattaaatctgaatggcacc
cactccttgatgaagaaactgcagcacctttttgctttcctggctcacactcagcgagaa
gcttatgcaccgcagatattttttgatgcttctagaccgccatggttcacaccacgttcc
cagcaagactgttctgaatatctcaggtttcttttggacagactggatgaagaagagaaa
accattaaagctctttgttccaaattgccttcagatgctccagttaccgactgcagtgtt
gtagaatcttcagcttcagtctcggatgacatttctaatcactattgcacaaaagagagc
aagggctgtggcaataaagaaaaaactttaatagaacatatgtttggaggaaagctacaa
actaatatttgttgtttgaactgcagaagtacttcacagaaaagggaagccttcaccgac
ctttccctcgctttctgtcctaccttagttgacaaacctgtacagagtaccctagactcc
ccaaagcaaaaagatgacgactgtatagaaattgatataactccttctgttgaagctcct
tctatacttgctccttcaacagaagatgttactgttaggccagcaaaagacaaatccgaa
tatgaagtgaagatgaatgacaattgcgttttggacaactctgaatgtgcaaatgcagtt
gagtctgataacatgtccgcccaaaacaatagaagagaaaaaactatctctgttacagac
ttgctaaactattttctggccccggagatccttgatggtgataatcagtattattgtgaa
aagtgtgcttcccttcagaatgctgaaaagactatgcaaatcatggaagagccagaatac
ctcatcctaacactactacggttttcatatgatccaaagtgtcatgtgaggcgtaagatc
acagataatgtatctatccctctggtgctggatttgcccatagaaagaactacctcttca
acctcaccagcagattgggcaatagaaactaacgtccctgatgttactgagaatcttgct
aaaaagctgaagccctcgaatacagaggatctttgctgtacacgtctagtaccttatgtt
ttaagttctgttgtggtacattctggcacatcatctgagagtggccattattattcatat
gccaggaatgttacaagctcagaaagatgtctgtatgctgagaaatcctgctattctcat
ggtcagttggtaggaagagaaactggcagctcagttatgacacacaatgacgcacaatgc
aatgatatctccaaggattggtttctcttcaatgacagcagggtaacgtttacatctttc
caatctgtttttaatatcaccagtaggtttccaaaggacactgcatatgtgcttatttat
agaaagcataacttgggcgatttaaatcgcatccagtctagttcagctaatggactctgg
gtaaatggtgaaccaccacttcagaaggagctcctggatgctattacaaaagataatctt
ctgtacttacaggaacaagaacttaatgcccgcactcgtgctctgcaaaacacttctgcc
tcctgctcctttcgacctaatggatttgatgacaacgaccctccaggaagctgtggcccc
agtggaggtggaggagatggaggatttagtacccttggcagacttgtcttttaa

DBGET integrated database retrieval system