KEGG   Xenopus laevis (African clawed frog): 447519Help
Entry
447519            CDS       T01010                                 

Gene name
nup205.L, nup205, xnup205
Definition
(RefSeq) nucleoporin 205kDa L homeolog
  KO
K14310  
nuclear pore complex protein Nup205
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:xla00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    447519 (nup205.L)
Messenger RNA biogenesis [BR:xla03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     447519 (nup205.L)
Chromosome [BR:xla03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Spindle formation proteins
    447519 (nup205.L)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
AA seq 2011 aa AA seqDB search
MAAQLALNSEASLWGPYREIWQTVLSALIKRQPEAVHSLDIVLKKYKPDFISLFKNPPKS
AQQHERVQKASTEGIPIKGTQRTRILEEQLIKEAFILSDLYNIGEIAAVELLLIGEQQQP
TFHGLTRGLVAILLYWDGKSCMAESLLHLIQARKGKTFTLDHSPEVVSMVTRFTDDLMEQ
GLTNKILTLISQIDVNNEFDKLKKERGLGNKKHRKEVSDLIKECQQSLAHSLYSWSCQTP
LNREDTLLLIGYLEKVTVEGDGSLDKVNLTLLMSLLYCLDVGFLEQGTDDREELMKQASM
FMDRQYIAAIHNRLQNTQPWKSPGMQATVRLAWALALRGISQFSEVLEFSEADEPMAEIA
IGGNVFLFLTEAVVGSESFCTDEFFIRRIHKLVTDFPTLMPMKVKQLRNRAEEDARLIQM
SMQMGNEPPASLRRDLEHLLLLIGELYRKDPFHLELALEYWCPTEPLQSTSLMGSFLGVA
HQRPPQRQVLLSKFVRQMSDLLPATLYLPYLKMLRGLASGPQCAHYCFSLLKANGGSSAE
NLQAAGGSPVSWDHFFHSLMLYHEHLRRDLPNTDNIHQRHPPLRGITQRELDGLIACLQL
TCTIIDWSESARLALCEHAQWMPVVVILGLLQCSIPPLLKAELLKTLAAFGKSPEIAASL
WQSLEYTQILQTVRATGLRQGVGIEVELNEIESRCEEYPLTRAFCQLISTLVESSFPTNL
GAGLRAPGFEPYLQFLRDTVFLRYRTRAYRRAAEKWEVAEAVLDVFYKLLKDYEPQPEDF
VDQYVELQGEERVAFKPPGFSLMHHLLNESPMLELCLSLMEEGVTQLDTYAPFPGKKHLE
KAVAYCFMLLNLTLQKENRFMDLLRESHLSMIVTPLEQLLQGINPRSKKADNVVNIARYL
CHGNSNAELAFESAKILCSISCNSKIQEKIVGDFTQDQNVSQKLMVGFVSCLDSEEAEEL
LDSEKEAEDQVKQTNIRYMTKIHILNLLITSLEMKAPNLAMFLLGYELKKPVSTTNLQDS
GVLGCPRTCLHSILDILRKGTDVRAGPVAVWDTPHLAELCYQVIYQLCACADTSGPTMRY
LRTSQDFLFSQLQHLPFSVEESEISAMNQMSWLMKTATIELRITSLNRQRSHTQRLLHLL
LDDMPTRPYSADGEGGMEDESRSLSGFLHFDTTSKVRRKILRILDSIQFSNEIPEPLQLD
FFDRSQIEQVIANCEHKNRRGQTVCNVKLLHRVLVAEVNALQGMAAIGQRPLLMEEINTI
LQYVVERNKLLQCLHAKRHALESWRQLVEIILTACPQDLIPTEHRQLIIRDLLQDLHVKI
LDDDAAQELMPIVAGAVFTLTAHLSQSVRTELKQPMTASGLGQSQYVQMLDGSFAAPPGT
ENISAGFASIGDSSLHMILRNLLEFILKTGGGFQRVRAHLYGSLLYYLQIAQRPDEPDTL
ESAHKSMWERLTAPEDVFSKLQRDNLSIFESYGTALMEVVCRDACDGHDIGRMLALALLD
RIVSVDRQQQWLLYLSNSGYLKVLVDSLAEDDVVLRNLLTPQPPLLKALYIYESKMAFLT
RVAKSSQGAIELLRSGVIVRLAQCQVYDMRPETDPHGVFGMRETPVFIPAPVERYRQILL
PALQICQLILTSSTAQHLQAAGQVLQFLVAHSDTIQAILRSQEGSLGSLQELALLTGIIS
KAALPGVLNELDIGLNDGSMMELQGHIGRFQRQCLALLNRFGGSDRLRQLSLQDDSSRLD
GVSKKDDMELAMQQICSNVMEYCQALMIQNSPSFQQTVCLFTPSLKESASRDGTRQDSQV
SILPSWRLPSLGVVIHLLKQSANNFFTYYDIHRQSVGKLQNVEQLPPDEIKELCQSEMPV
GADKISTTQKYGLARRRLVKLINSRAKLLSLCSYIIETCLYILWRHLEYYLLHCTTSDSQ
DPVFSNMTFGNRRFQDTFNTDPNMDPRNLRQNKVSQQDVDTLLREGANSFGESLQKRLLD
IESLYCKVRSRHSFIQALVRRIRGLLRVSRV
NT seq 6036 nt NT seq  +upstreamnt  +downstreamnt
atggcggctcagttggcgctaaattcagaagccagcctgtggggtccttacagagaaata
tggcagacggtgctgagcgcgctcatcaagaggcagccggaagccgttcattcgcttgac
attgtcttgaagaaatataaaccggacttcatctctctcttcaaaaacccgccaaagagc
gctcagcaacatgagagagtccagaaagccagcacggaggggatccctattaaagggacg
cagcgcacccggatcctggaagaacagcttattaaggaagcctttatccttagtgacttg
tataatattggagagatagcagctgtggaacttctgcttataggtgagcaacagcagcct
actttccatggcctgaccagaggcttggtagcgatactcttatactgggacggcaagagc
tgcatggctgaatccttattacatctcatccaggccagaaaaggcaagaccttcactttg
gaccacagccccgaggttgtgtccatggtaactcgtttcaccgatgatctgatggaacaa
ggcttgactaataaaatccttactttgatctctcaaattgacgtgaacaatgagtttgac
aagttgaaaaaggaacgaggtctgggcaataagaagcatcgcaaagaggtttctgatctg
ataaaagaatgccagcaatccctagcacacagcctgtattcatggagctgccagactcca
ttaaacagagaggatacgctacttttgattggatacttggaaaaagtaaccgtagaagga
gatggctcattggacaaagtgaacttgacactactgatgtcacttctctattgcctggat
gttggctttttggagcaagggacagatgatcgagaagaactgatgaagcaagcaagcatg
ttcatggacagacagtacattgctgctatccataatcgtctgcagaacactcagccatgg
aagtcacccggcatgcaggcgacagtcagactggcttgggccctggctctccgaggaatc
tctcagttttcagaagtcttagagttttcagaagcagatgagccaatggcagagatagct
attggtggcaatgtctttctcttcctcacggaggcagtggtgggatctgaaagcttctgc
acagacgaattctttattcgccggattcacaaactcgtcactgatttcccgactctcatg
cccatgaaagtaaagcaactgagaaatcgtgcagaagaggatgcccgactgatccaaatg
agcatgcagatggggaatgagcctcctgcttctctacgtagagatctggaacatcttctg
ttactgattggcgagctgtaccgcaaagacccattccacctggaactggcattggaatac
tggtgtcccacagaacctctccaatcaacctctttgatgggatcctttcttggtgtggcc
caccaaaggccacctcaacgccaggttttattgtccaagttcgtgagacagatgagtgac
ctattgccagccacgctctacttaccttacctgaagatgctcaggggccttgcaagtggc
cctcagtgtgcccattactgtttcagtctactcaaagccaatgggggcagcagcgcagag
aacttgcaagctgcagggggcagcccagtgtcctgggaccacttcttccactctctgatg
ctgtaccacgagcacttacggagggatctacctaacactgacaatatccaccagcgtcac
cctcctctccgtggtatcacccagcgagagcttgatggcctcattgcctgcttgcagctc
acctgcaccatcatcgattggagtgaaagtgcccgtctggctctgtgtgagcatgcccag
tggatgccggtggtcgttattcttggcctcttgcagtgcagcatcccacctctccttaaa
gctgagctcctgaagacactggctgcctttggtaaatccccagagattgctgcatcccta
tggcaatcccttgaatatacacagattctgcagacagtaagagccacaggtctacggcaa
ggagtaggaatcgaggtggagctgaatgagattgagtctcgttgtgaagagtaccccctg
actagagctttctgccagctcattagtactttagttgaaagctccttccccaccaatctg
ggagcaggtctgagagcacctggctttgagccgtacctccagtttcttcgagacaccgtg
ttccttaggtaccgcactagagcctacaggagagcagcagaaaagtgggaggtagctgag
gctgtgttggatgtcttttataagcttttgaaggactatgaacctcagcctgaagacttt
gtggaccagtatgtagagctgcaaggagaagaaagggttgctttcaaacccccggggttc
agcctcatgcatcatctgctcaatgagtctcccatgttggagctttgcctcagcctcatg
gaagaaggggtcacccagctggacacatatgccccttttccaggcaagaaacacctagag
aaggcagtggcttattgtttcatgcttctgaatctgactctacagaaggagaatcgcttc
atggatttgttaagggaaagtcacctgtcgatgatcgtgacccctctggagcagctcttg
cagggaattaacccacgatccaagaaagctgataatgtagtgaatattgctcgatatctc
tgccatggaaacagcaatgctgagcttgcctttgaaagtgcaaagatcttgtgcagcatc
tcctgtaactctaagatccaagaaaagattgttggagactttacccaagatcagaatgtg
agccagaagctgatggttggctttgtttcgtgcttggacagtgaggaagcagaagagtta
ctggattcagagaaagaggcggaggatcaagtgaagcagaccaacattaggtacatgaca
aaaattcacatcctcaatcttctaatcacctccctggaaatgaaagctcccaatcttgcg
atgttccttcttggctatgaactgaagaagccagtcagtacaaccaacctgcaggactca
ggtgtcctgggctgcccgcgcacctgcctgcactctattctagatatcttgcgaaagggg
actgatgtgcgggctggacctgtagcggtgtgggacactcctcatcttgctgaactgtgt
taccaggtgatctaccagctgtgtgcttgtgccgatacctccggccctacaatgaggtac
ctacgaaccagccaggatttcctcttcagccagcttcagcacctgcccttctctgtggaa
gagtccgaaatctctgccatgaatcagatgtcatggctgatgaagacggccaccatagaa
ctgcgcatcacatcactaaaccgtcagcgttcccacacacagaggcttcttcacctgctt
ctggatgacatgccgaccagaccgtattcagctgatggtgaaggaggaatggaggacgaa
agccgcagcctcagtgggtttctgcactttgacacaacctctaaagttcgcagaaaaatc
ctccgcatcctggactctatacagttcagcaatgagatcccggagcccctgcagctggat
tttttcgatcgcagtcagatagagcaagttattgctaactgtgagcacaagaatcgcaga
gggcagaccgtctgcaacgtcaagctactccatcgggttctggttgcagaagtgaacgcc
cttcagggaatggctgctattggtcagaggcctttgctcatggaggaaataaacacaatc
cttcagtacgtggtggaaaggaacaagttattgcagtgtctccatgctaaacgtcatgct
ctggaatcttggcggcagcttgttgagatcatactgactgcctgtccccaggatcttatc
ccaacggaacacagacagctcatcatacgggacctgctgcaagatctccatgttaagatc
cttgatgatgatgctgcccaagaactaatgcccatcgttgccggggcagtctttacccta
accgctcatctcagccaatccgttcgcaccgagctgaaacagccaatgactgcttcaggg
ctgggccaatcacaatatgtccaaatgttggacggttcttttgctgcccctcctggtaca
gaaaatatctctgctggtttcgcctccattggagactcttcccttcacatgatcctcagg
aatctgcttgagttcattctaaaaacaggaggtgggttccaacgggtcagggcccacctg
tatggatctctgctgtattacctgcaaattgctcagagaccggatgaaccagatactctg
gaatcagcccacaagtctatgtgggagcgactgactgccccggaggatgtgttcagtaaa
cttcagcgagacaacctgtccatatttgagagctacggcacggccctgatggaagtggtt
tgccgggacgcatgcgacggacatgatattgggaggatgctggctctggcactgcttgac
cggattgtgtctgtggacaggcaacaacaatggctgctgtatctctcaaacagtggctac
ctgaaggttcttgtggatagcctggcagaggatgacgtggttctaaggaacctgctaact
cctcagcctccgctcctgaaggccctctatatctatgagtcgaaaatggcatttctaact
cgagtggctaaaagctcacagggagccattgagctgctgaggagtggggttatagtcaga
ctcgctcagtgccaagtatatgacatgcgtccagagactgacccccatggagtgtttggc
atgagggagactcctgtgtttatcccggccccggtggaaagatacaggcaaatcctgctc
cccgcactccagatctgtcagctcatcctgacctccagcaccgcacaacacttacaggcc
gcgggacaggtgttgcagttcctggtcgctcattcggacaccattcaagcaattctcagg
agccaggagggaagtcttggttccttgcaggagctggctttgcttacaggtatcatcagc
aaggctgcacttccaggtgttctcaacgagctggatatcggtttaaacgatgggtcaatg
atggagttacaaggacatattggacgcttccagcgccagtgtcttgcattattaaaccgc
ttcggggggtccgatagacttcggcagctcagtctgcaggatgattcctcccggctggac
ggagtaagcaagaaggacgacatggaattagccatgcaacagatctgctccaacgtgatg
gagtactgccaggccctcatgatccagaactctccgagcttccagcaaactgtgtgtctc
ttcacccccagcctcaaggagagcgccagccgagatgggacacgacaagattcccaagtg
tccattctcccctcgtggcgtttgccaagcctgggtgtagtgatccaccttctgaagcaa
agcgccaacaacttcttcacttactacgatattcaccggcagagcgtcggcaaactgcag
aacgtcgagcagctgccaccagatgaaattaaagagctttgccagtcagagatgccggtc
ggtgcagataaaatctcaaccacccagaagtacggcctggcacggcggcgacttgtcaag
ctcattaacagcagagccaaactgctttccctctgtagctatatcatagaaacgtgtcta
tacattctgtggcgccacttggaatattaccttctacactgcaccaccagcgattcccag
gaccccgtcttctcaaatatgaccttcggcaacagaagatttcaagatacatttaacact
gatcccaacatggacccgaggaaccttagacagaataaagtcagccaacaggacgttgat
acgctgctgagagaaggtgccaatagttttggggagtccctgcagaagcgactgttagac
atcgaatcgttatattgcaaggtgcgatcccgtcacagcttcattcaggcgctggtccgg
cgaatcagaggcctcctgcgggtgtcaagagtttga

DBGET integrated database retrieval system