KEGG   Xenopus laevis (African clawed frog): 447519Help
Entry
447519            CDS       T01010                                 

Gene name
nup205, xnup205
Definition
nucleoporin 205kDa
Orthology
K14310  
nuclear pore complex protein Nup205
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:xla00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    447519 (nup205)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
AA seq 2011 aa AA seqDB search
MAAQLALNSEASLWGPYREIWQTVLSALIKRQPEAVHSLDIVLKKYKPDFISLFKNPPKS
AQQHERVQKASTEGIPIKGTQRTRILEEQLIKEAFILSDLYNIGEIAAVELLLIGEQQQP
TFHGLTRGLVAILLYWDGKSCMAESLLHLIQARKGKTFTLDHSPEVVSMVTRFTDDLMEQ
GLTNKILTLISQIDVNNEFDKLKKERGLGNKKHRKEVSDLIKECQQSLAHSLYSWSCQTP
LNREDTLLLIGYLEKVTVEGDGSLDKVNLTLLMSLLYCLDVGFLEQGTDDREELMKQASM
FMDRQYIAAIHNRLQNTQPWKSPGMQATVRLAWALALRGISQFSEVLEFSEADEPMAEIA
IGGNVFLFLTEAVVGSESFCTDEFFIRRIHKLVTDFPTLMPMKVKQLRNRAEEDARLIQM
SMQMGNEPPASLRRDLEHLLLLIGELYRKDPFHLELALEYWCPTEPLQSTSLMGSFLGVA
HQRPPQRQVLLSKFVRQMSDLLPATLYLPYLKMLRGLASGPQCAHYCFSLLKANGGSSAE
NLQAAGGSPVSWDHFFHSLMLYHEHLRRDLPNTDNIHQRHPPLRGITQRELDGLIACLQL
TCTIIDWSESARLALCEHAQWMPVVVILGLLQCSIPPLLKAELLKTLAAFGKSPEIAASL
WQSLEYTQILQTVRATGLRQGVGIEVELNEIESRCEEYPLTRAFCQLISTLVESSFPTNL
GAGLRAPGFEPYLQFLRDTVFLRYRTRAYRRAAEKWEVAEAVLDVFYKLLKDYEPQPEDF
VDQYVELQGEERVAFKPPGFSLMHHLLNESPMLELCLSLMEEGVTQLDTYAPFPGKKHLE
KAVAYCFMLLNLTLQKENRFMDLLRESHLSMIVTPLEQLLQGINPRSKKADNVVNIARYL
CHGNSNAELAFESAKILCSISCNSKIQEKIVGDFTQDQNVSQKLMVGFVSCLDSEEAEEL
LDSEKEAEDQVKQTNIRYMTKIHILNLLITSLEMKAPNLAMFLLGYELKKPVSTTNLQDS
GVLGCPRTCLHSILDILRKGTDVRAGPVAVWDTPHLAELCYQVIYQLCACADTSGPTMRY
LRTSQDFLFSQLQHLPFSVEESEISAMNQMSWLMKTATIELRITSLNRQRSHTQRLLHLL
LDDMPTRPYSADGEGGMEDESRSLSGFLHFDTTSKVRRKILRILDSIQFSNEIPEPLQLD
FFDRSQIEQVIANCEHKNRRGQTVCNVKLLHRVLVAEVNALQGMAAIGQRPLLMEEINTI
LQYVVERNKLLQCLHAKRHALESWRQLVEIILTACPQDLIPTEHRQLIIRDLLQDLHVKI
LDDDAAQELMPIVAGAVFTLTAHLSQSVRTELKQPMTASGLGQSQYVQMLDGSFAAPPGT
ENISAGFASIGDSSLHMILRNLLEFILKTGGGFQRVRAHLYGSLLYYLQIAQRPDEPDTL
ESAHKSMWERLTAPEDVFSKLQRDNLSIFESYGTALMEVVCRDACDGHDIGRMLALALLD
RIVSVDRQQQWLLYLSNSGYLKVLVDSLAEDDVVLRNLLTPQPPLLKALYIYESKMAFLT
RVAKSSQGAIELLRSGVIVRLAQCQVYDMRPETDPHGVFGMRETPVFIPAPVERYRQILL
PALQICQLILTSSTAQHLQAAGQVLQFLVAHSDTIQAILRSQEGSLGSLQELALLTGIIS
KAALPGVLNELDIGLNDGSMMELQGHIGRFQRQCLALLNRFGGSDRLRQLSLQDDSSRLD
GVSKKDDMELAMQQICSNVMEYCQALMIQNSPSFQQTVCLFTPSLKESASRDGTRQDSQV
SILPSWRLPSLGVVIHLLKQSANNFFTYYDIHRQSVGKLQNVEQLPPDEIKELCQSEMPV
GADKISTTQKYGLARRRLVKLINSRAKLLSLCSYIIETCLYILWRHLEYYLLHCTTSDSQ
DPVFSNMTFGNRRFQDTFNTDPNMDPRNLRQNKVSQQDVDTLLREGANSFGESLQKRLLD
IESLYCKVRSRHSFIQALVRRIRGLLRVSRV
NT seq 6036 nt NT seq  +upstreamnt  +downstreamnt
atggcggctcagttggcgctaaattcagaagccagcctgtggggtccttacagagaaata
tggcagacggtgctgagcgcgctcatcaagaggcagccggaagccgttcattcgcttgac
attgtcttgaagaaatataaaccggacttcatctctctcttcaaaaacccgccaaagagc
gctcagcaacatgagagagtccagaaagccagcacggaggggatccctattaaagggacg
cagcgcacccggatcctggaagaacagcttattaaggaagcctttatccttagtgacttg
tataatattggagagatagcagctgtggaacttctgcttataggtgagcaacagcagcct
actttccatggcctgaccagaggcttggtagcgatactcttatactgggacggcaagagc
tgcatggctgaatccttattacatctcatccaggccagaaaaggcaagaccttcactttg
gaccacagccccgaggttgtgtccatggtaactcgtttcaccgatgatctgatggaacaa
ggcttgactaataaaatccttactttgatctctcaaattgacgtgaacaatgagtttgac
aagttgaaaaaggaacgaggtctgggcaataagaagcatcgcaaagaggtttctgatctg
ataaaagaatgccagcaatccctagcacacagcctgtattcatggagctgccagactcca
ttaaacagagaggatacgctacttttgattggatacttggaaaaagtaaccgtagaagga
gatggctcattggacaaagtgaacttgacactactgatgtcacttctctattgcctggat
gttggctttttggagcaagggacagatgatcgagaagaactgatgaagcaagcaagcatg
ttcatggacagacagtacattgctgctatccataatcgtctgcagaacactcagccatgg
aagtcacccggcatgcaggcgacagtcagactggcttgggccctggctctccgaggaatc
tctcagttttcagaagtcttagagttttcagaagcagatgagccaatggcagagatagct
attggtggcaatgtctttctcttcctcacggaggcagtggtgggatctgaaagcttctgc
acagacgaattctttattcgccggattcacaaactcgtcactgatttcccgactctcatg
cccatgaaagtaaagcaactgagaaatcgtgcagaagaggatgcccgactgatccaaatg
agcatgcagatggggaatgagcctcctgcttctctacgtagagatctggaacatcttctg
ttactgattggcgagctgtaccgcaaagacccattccacctggaactggcattggaatac
tggtgtcccacagaacctctccaatcaacctctttgatgggatcctttcttggtgtggcc
caccaaaggccacctcaacgccaggttttattgtccaagttcgtgagacagatgagtgac
ctattgccagccacgctctacttaccttacctgaagatgctcaggggccttgcaagtggc
cctcagtgtgcccattactgtttcagtctactcaaagccaatgggggcagcagcgcagag
aacttgcaagctgcagggggcagcccagtgtcctgggaccacttcttccactctctgatg
ctgtaccacgagcacttacggagggatctacctaacactgacaatatccaccagcgtcac
cctcctctccgtggtatcacccagcgagagcttgatggcctcattgcctgcttgcagctc
acctgcaccatcatcgattggagtgaaagtgcccgtctggctctgtgtgagcatgcccag
tggatgccggtggtcgttattcttggcctcttgcagtgcagcatcccacctctccttaaa
gctgagctcctgaagacactggctgcctttggtaaatccccagagattgctgcatcccta
tggcaatcccttgaatatacacagattctgcagacagtaagagccacaggtctacggcaa
ggagtaggaatcgaggtggagctgaatgagattgagtctcgttgtgaagagtaccccctg
actagagctttctgccagctcattagtactttagttgaaagctccttccccaccaatctg
ggagcaggtctgagagcacctggctttgagccgtacctccagtttcttcgagacaccgtg
ttccttaggtaccgcactagagcctacaggagagcagcagaaaagtgggaggtagctgag
gctgtgttggatgtcttttataagcttttgaaggactatgaacctcagcctgaagacttt
gtggaccagtatgtagagctgcaaggagaagaaagggttgctttcaaacccccggggttc
agcctcatgcatcatctgctcaatgagtctcccatgttggagctttgcctcagcctcatg
gaagaaggggtcacccagctggacacatatgccccttttccaggcaagaaacacctagag
aaggcagtggcttattgtttcatgcttctgaatctgactctacagaaggagaatcgcttc
atggatttgttaagggaaagtcacctgtcgatgatcgtgacccctctggagcagctcttg
cagggaattaacccacgatccaagaaagctgataatgtagtgaatattgctcgatatctc
tgccatggaaacagcaatgctgagcttgcctttgaaagtgcaaagatcttgtgcagcatc
tcctgtaactctaagatccaagaaaagattgttggagactttacccaagatcagaatgtg
agccagaagctgatggttggctttgtttcgtgcttggacagtgaggaagcagaagagtta
ctggattcagagaaagaggcggaggatcaagtgaagcagaccaacattaggtacatgaca
aaaattcacatcctcaatcttctaatcacctccctggaaatgaaagctcccaatcttgcg
atgttccttcttggctatgaactgaagaagccagtcagtacaaccaacctgcaggactca
ggtgtcctgggctgcccgcgcacctgcctgcactctattctagatatcttgcgaaagggg
actgatgtgcgggctggacctgtagcggtgtgggacactcctcatcttgctgaactgtgt
taccaggtgatctaccagctgtgtgcttgtgccgatacctccggccctacaatgaggtac
ctacgaaccagccaggatttcctcttcagccagcttcagcacctgcccttctctgtggaa
gagtccgaaatctctgccatgaatcagatgtcatggctgatgaagacggccaccatagaa
ctgcgcatcacatcactaaaccgtcagcgttcccacacacagaggcttcttcacctgctt
ctggatgacatgccgaccagaccgtattcagctgatggtgaaggaggaatggaggacgaa
agccgcagcctcagtgggtttctgcactttgacacaacctctaaagttcgcagaaaaatc
ctccgcatcctggactctatacagttcagcaatgagatcccggagcccctgcagctggat
tttttcgatcgcagtcagatagagcaagttattgctaactgtgagcacaagaatcgcaga
gggcagaccgtctgcaacgtcaagctactccatcgggttctggttgcagaagtgaacgcc
cttcagggaatggctgctattggtcagaggcctttgctcatggaggaaataaacacaatc
cttcagtacgtggtggaaaggaacaagttattgcagtgtctccatgctaaacgtcatgct
ctggaatcttggcggcagcttgttgagatcatactgactgcctgtccccaggatcttatc
ccaacggaacacagacagctcatcatacgggacctgctgcaagatctccatgttaagatc
cttgatgatgatgctgcccaagaactaatgcccatcgttgccggggcagtctttacccta
accgctcatctcagccaatccgttcgcaccgagctgaaacagccaatgactgcttcaggg
ctgggccaatcacaatatgtccaaatgttggacggttcttttgctgcccctcctggtaca
gaaaatatctctgctggtttcgcctccattggagactcttcccttcacatgatcctcagg
aatctgcttgagttcattctaaaaacaggaggtgggttccaacgggtcagggcccacctg
tatggatctctgctgtattacctgcaaattgctcagagaccggatgaaccagatactctg
gaatcagcccacaagtctatgtgggagcgactgactgccccggaggatgtgttcagtaaa
cttcagcgagacaacctgtccatatttgagagctacggcacggccctgatggaagtggtt
tgccgggacgcatgcgacggacatgatattgggaggatgctggctctggcactgcttgac
cggattgtgtctgtggacaggcaacaacaatggctgctgtatctctcaaacagtggctac
ctgaaggttcttgtggatagcctggcagaggatgacgtggttctaaggaacctgctaact
cctcagcctccgctcctgaaggccctctatatctatgagtcgaaaatggcatttctaact
cgagtggctaaaagctcacagggagccattgagctgctgaggagtggggttatagtcaga
ctcgctcagtgccaagtatatgacatgcgtccagagactgacccccatggagtgtttggc
atgagggagactcctgtgtttatcccggccccggtggaaagatacaggcaaatcctgctc
cccgcactccagatctgtcagctcatcctgacctccagcaccgcacaacacttacaggcc
gcgggacaggtgttgcagttcctggtcgctcattcggacaccattcaagcaattctcagg
agccaggagggaagtcttggttccttgcaggagctggctttgcttacaggtatcatcagc
aaggctgcacttccaggtgttctcaacgagctggatatcggtttaaacgatgggtcaatg
atggagttacaaggacatattggacgcttccagcgccagtgtcttgcattattaaaccgc
ttcggggggtccgatagacttcggcagctcagtctgcaggatgattcctcccggctggac
ggagtaagcaagaaggacgacatggaattagccatgcaacagatctgctccaacgtgatg
gagtactgccaggccctcatgatccagaactctccgagcttccagcaaactgtgtgtctc
ttcacccccagcctcaaggagagcgccagccgagatgggacacgacaagattcccaagtg
tccattctcccctcgtggcgtttgccaagcctgggtgtagtgatccaccttctgaagcaa
agcgccaacaacttcttcacttactacgatattcaccggcagagcgtcggcaaactgcag
aacgtcgagcagctgccaccagatgaaattaaagagctttgccagtcagagatgccggtc
ggtgcagataaaatctcaaccacccagaagtacggcctggcacggcggcgacttgtcaag
ctcattaacagcagagccaaactgctttccctctgtagctatatcatagaaacgtgtcta
tacattctgtggcgccacttggaatattaccttctacactgcaccaccagcgattcccag
gaccccgtcttctcaaatatgaccttcggcaacagaagatttcaagatacatttaacact
gatcccaacatggacccgaggaaccttagacagaataaagtcagccaacaggacgttgat
acgctgctgagagaaggtgccaatagttttggggagtccctgcagaagcgactgttagac
atcgaatcgttatattgcaaggtgcgatcccgtcacagcttcattcaggcgctggtccgg
cgaatcagaggcctcctgcgggtgtcaagagtttga

DBGET integrated database retrieval system