KEGG   Xenopus laevis (African clawed frog): 447570Help
Entry
447570            CDS       T01010                                 

Definition
MGC84284 protein
Orthology
K01201  
glucosylceramidase [EC:3.2.1.45]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Lysosome
Brite
KEGG Orthology (KO) [BR:xla00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    447570
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    447570
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    447570
Enzymes [BR:xla01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     447570
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 236 aa AA seqDB search
MWSWFLPILGVLVLARGSSGGRLCAPLNFGQSSVVCQCNATYCDTLDPIVVPSVGNFSVY
ETSQSGKRLQVTSGTFTKRQPSPMDLVLTLNDKKKFQTIKGFGGAVTDSAALNILSLSDE
TKENLLRSYFSEEGIGYNILRVPMGSCDFSTRIYTYLDTEGDFSMKTFSLQVEDTKLKIP
LIQKAKELSNRSISLFASPWTSPPWMKTNGAITGKGTLKGKPGDQYHKTWANYFIR
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atgtggtcctggttcctcccaattctgggggtgctcgtcctggctcggggctcctcggga
gggcgcctctgtgccccattgaatttcggacagagttcagttgtgtgtcagtgtaacgcc
acctactgtgacactctggaccccattgtcgtcccatctgtgggcaacttcagcgtctat
gagacgagccagtctgggaaacgtctgcaagtcacgtctggaaccttcaccaagaggcaa
ccatccccaatggatcttgtgctgacgctcaatgataagaagaagttccagaccattaag
ggattcggtggagcagtgacggactcggccgcactcaatatattgtccctttcagatgag
accaaggaaaacctgctcagatcctacttctcagaggaaggtattggctacaacattttg
cgggttcctatgggcagctgtgacttctccacacggatctacacttacctggacaccgag
ggagacttcagcatgaagacgttcagcctgcaggtggaggacaccaagttaaagattcct
cttatccagaaggccaaagagttgtccaacaggtccatctctctctttgcgagtccttgg
acatcccccccatggatgaagaccaatggggccattactgggaagggaaccttgaaaggg
aagcctggagatcaatatcacaagacctgggccaactattttatcaggtaa

DBGET integrated database retrieval system