KEGG   Xenopus laevis (African clawed frog): 447594Help
Entry
447594            CDS       T01010                                 

Gene name
pik3r3.L, p55, p55-gamma, pik3r3
Definition
(RefSeq) phosphoinositide-3-kinase regulatory subunit 3 L homeolog
  KO
K02649  
phosphoinositide-3-kinase regulatory subunit alpha/beta/delta
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
ErbB signaling pathway
FoxO signaling pathway
Phosphatidylinositol signaling system
Autophagy - animal
mTOR signaling pathway
Apoptosis
VEGF signaling pathway
Focal adhesion
Toll-like receptor signaling pathway
Regulation of actin cytoskeleton
Insulin signaling pathway
Progesterone-mediated oocyte maturation
AGE-RAGE signaling pathway in diabetic complications
Module
PI3K-Akt signaling
Brite
KEGG Orthology (KO) [BR:xla00001]
 Environmental Information Processing
  Signal transduction
   04012 ErbB signaling pathway
    447594 (pik3r3.L)
   04370 VEGF signaling pathway
    447594 (pik3r3.L)
   04068 FoxO signaling pathway
    447594 (pik3r3.L)
   04070 Phosphatidylinositol signaling system
    447594 (pik3r3.L)
   04150 mTOR signaling pathway
    447594 (pik3r3.L)
 Cellular Processes
  Transport and catabolism
   04140 Autophagy - animal
    447594 (pik3r3.L)
  Cell growth and death
   04210 Apoptosis
    447594 (pik3r3.L)
  Cellular community - eukaryotes
   04510 Focal adhesion
    447594 (pik3r3.L)
  Cell motility
   04810 Regulation of actin cytoskeleton
    447594 (pik3r3.L)
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    447594 (pik3r3.L)
  Endocrine system
   04910 Insulin signaling pathway
    447594 (pik3r3.L)
   04914 Progesterone-mediated oocyte maturation
    447594 (pik3r3.L)
 Human Diseases
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    447594 (pik3r3.L)
Membrane trafficking [BR:xla04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    447594 (pik3r3.L)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
Position
4L
AA seq 461 aa AA seqDB search
MYNTVWNMDQDDADWREVMMPYSTELIFYIEMDPPALPPKPPKSMTSLSTEGSKENTTSL
QDAEWYWGDISREEVNDKLRDMPDGTFLVRNASTKVQGDYTLTLRKGGNNKLIKIYHQDG
KYGFSDPLTFNSVVELINHYRHESLAQYNPKLDVKLFYPVSRYQQDQLVKEDNIDAVGRK
LQEYHGQFQDKSKEYDKLYEEYTKTSQEIQMKRTAIEAFNETIKIFEEQCHTQERYSKEY
MERFNREGNEKEMERIIMNSEKLKSRLGEIHDSKLRLEQDFKKQALDNREIDKKMNSIKP
DLLQLRKMRDQYLVWLNHKGVRQKRINDWLGIKNENIDDIYFVSEEEENLPHYDEKTWFV
GDLNRIQAEELLSGKPDGAFLIRESSKKGCYACSVVIDGDVKHCVIYSTSRGYGFAEPYN
LYSTLKELVLHYQHTSLVQHNDSLNVRLAYPVYAQMPSLCR
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atgtacaacaccgtgtggaatatggaccaagatgatgcagactggagggaagttatgatg
ccttattccaccgaactgatcttttatatagagatggaccccccagcacttcctcctaaa
ccaccaaaatcgatgacttcattgtctacagaaggaagcaaagagaacacaacttctctt
caggatgccgaatggtactggggagacatctcaagggaagaggtaaatgataaacttcgt
gatatgccagatggtaccttcctggttcgtaatgcatctaccaaggtgcaaggcgattat
actttgacactgcggaaagggggcaataacaaactgataaagatttatcatcaggatggc
aaatatggtttttctgatccattgacttttaactctgtcgtggagttgataaaccattat
agacatgaatccctggcacaatacaatcctaaactggatgtgaagttgttctatccagtg
tcaagataccaacaggatcagctagtcaaagaagataacattgatgctgttggtaggaaa
cttcaagaataccatggtcagtttcaggataaaagcaaagaatatgacaaattgtatgaa
gaatatacaaaaacatcacaggaaattcagatgaagagaacggcaattgaagcctttaac
gagactattaaaatatttgaagaacagtgccatacacaagaacgctatagtaaagaatac
atggagcgtttcaatagggagggcaatgaaaaggaaatggaaaggataataatgaattct
gagaaattaaaatctcgtttgggtgagattcatgacagtaaattacgcctggaacaagac
tttaagaaacaagctttagacaatagagaaatagacaaaaaaatgaacagtatcaagcct
gatcttcttcagctgcgtaaaatgagagatcaataccttgtatggctcaatcacaaagga
gtgaggcaaaagcgaataaatgactggctgggaatcaagaatgaaaatattgatgatatt
tattttgttagtgaggaggaagagaaccttccacattatgatgagaaaacctggttcgtt
ggtgatctcaaccgtatacaagcagaagaattactcagtggaaagccagatggagccttt
ctaattcgagaaagtagcaagaagggatgctatgcctgttctgttgtgattgatggtgat
gtgaagcactgtgtcatctacagtacatcaagggggtatggatttgcagagccatacaat
ctctacagtacactaaaagagttagtccttcattaccagcatacatcccttgtacaacat
aatgattcgcttaatgtcaggcttgcttatccagtctacgcacagatgccctccctctgc
agataa

DBGET integrated database retrieval system