KEGG   Xenopus laevis (African clawed frog): 447594Help
Entry
447594            CDS       T01010                                 

Definition
MGC84470 protein
Orthology
K02649  
phosphoinositide-3-kinase, regulatory subunit
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
ErbB signaling pathway
FoxO signaling pathway
Phosphatidylinositol signaling system
mTOR signaling pathway
Apoptosis
Adrenergic signaling in cardiomyocytes
VEGF signaling pathway
Focal adhesion
Toll-like receptor signaling pathway
Jak-STAT signaling pathway
Regulation of actin cytoskeleton
Insulin signaling pathway
Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:xla00001]
 Environmental Information Processing
  Signal transduction
   04012 ErbB signaling pathway
    447594
   04370 VEGF signaling pathway
    447594
   04630 Jak-STAT signaling pathway
    447594
   04068 FoxO signaling pathway
    447594
   04070 Phosphatidylinositol signaling system
    447594
   04150 mTOR signaling pathway
    447594
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    447594
  Cell growth and death
   04210 Apoptosis
    447594
  Cellular commiunity
   04510 Focal adhesion
    447594
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    447594
  Endocrine system
   04910 Insulin signaling pathway
    447594
   04914 Progesterone-mediated oocyte maturation
    447594
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    447594
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 461 aa AA seqDB search
MYNTVWNMDQDDADWREVMMPYSTELIFYIEMDPPALPPKPPKSMTSLSTEGSKENTTSL
QDAEWYWGDISREEVNDKLRDMPDGTFLVRNASTKVQGDYTLTLRKGGNNKLIKIYHQDG
KYGFSDPLTFNSVVELINHYRHESLAQYNPKLDVKLFYPVSRYQQDQLVKEDNIDAVGRK
LQEYHGQFQDKSKEYDKLYEEYTKTSQEIQMKRTAIEAFNETIKIFEEQCHTQERYSKEY
MERFNREGNEKEMERIIMNSEKLKSRLGEIHDSKLRLEQDFKKQALDNREIDKKMNSIKP
DLLQLRKMRDQYLVWLNHKGVRQKRINDWLGIKNENIDDIYFVSEEEENLPHYDEKTWFV
GDLNRIQAEELLSGKPDGAFLIRESSKKGCYACSVVIDGDVKHCVIYSTSRGYGFAEPYN
LYSTLKELVLHYQHTSLVQHNDSLNVRLAYPVYAQMPSLCR
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atgtacaacaccgtgtggaatatggaccaagatgatgcagactggagggaagttatgatg
ccttattccaccgaactgatcttttatatagagatggaccccccagcacttcctcctaaa
ccaccaaaatcgatgacttcattgtctacagaaggaagcaaagagaacacaacttctctt
caggatgccgaatggtactggggagacatctcaagggaagaggtaaatgataaacttcgt
gatatgccagatggtaccttcctggttcgtaatgcatctaccaaggtgcaaggcgattat
actttgacactgcggaaagggggcaataacaaactgataaagatttatcatcaggatggc
aaatatggtttttctgatccattgacttttaactctgtcgtggagttgataaaccattat
agacatgaatccctggcacaatacaatcctaaactggatgtgaagttgttctatccagtg
tcaagataccaacaggatcagctagtcaaagaagataacattgatgctgttggtaggaaa
cttcaagaataccatggtcagtttcaggataaaagcaaagaatatgacaaattgtatgaa
gaatatacaaaaacatcacaggaaattcagatgaagagaacggcaattgaagcctttaac
gagactattaaaatatttgaagaacagtgccatacacaagaacgctatagtaaagaatac
atggagcgtttcaatagggagggcaatgaaaaggaaatggaaaggataataatgaattct
gagaaattaaaatctcgtttgggtgagattcatgacagtaaattacgcctggaacaagac
tttaagaaacaagctttagacaatagagaaatagacaaaaaaatgaacagtatcaagcct
gatcttcttcagctgcgtaaaatgagagatcaataccttgtatggctcaatcacaaagga
gtgaggcaaaagcgaataaatgactggctgggaatcaagaatgaaaatattgatgatatt
tattttgttagtgaggaggaagagaaccttccacattatgatgagaaaacctggttcgtt
ggtgatctcaaccgtatacaagcagaagaattactcagtggaaagccagatggagccttt
ctaattcgagaaagtagcaagaagggatgctatgcctgttctgttgtgattgatggtgat
gtgaagcactgtgtcatctacagtacatcaagggggtatggatttgcagagccatacaat
ctctacagtacactaaaagagttagtccttcattaccagcatacatcccttgtacaacat
aatgattcgcttaatgtcaggcttgcttatccagtctacgcacagatgccctccctctgc
agataa

DBGET integrated database retrieval system