KEGG   Xenopus laevis (African clawed frog): 447691Help
Entry
447691            CDS       T01010                                 

Definition
MGC99250 protein
Orthology
K14527  
ribonuclease P/MRP protein subunit RPP20 [EC:3.1.26.5]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
Ribosome biogenesis in eukaryotes
RNA transport
Brite
KEGG Orthology (KO) [BR:xla00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    447691
   03008 Ribosome biogenesis in eukaryotes
    447691
Enzymes [BR:xla01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.26  Endoribonucleases producing 5'-phosphomonoesters
    3.1.26.5  ribonuclease P
     447691
Ribosome biogenesis [BR:xla03009]
 Eukaryotic Type
  Pre-60S particles
   RNases
    RNase MRP
     447691
Transfer RNA biogenesis [BR:xla03016]
 Eukaryotic Type
  5'processing factors
   Ribonucrease P
    447691
Mitochondrial biogenesis [BR:xla03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   RNase MRP
    447691
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 127 aa AA seqDB search
MAEQQPFCGRVHHTRRPAPRPPRSPNDIYVNTKSDFRAQLARCRQLVSSGDFREVRVHGL
GLAIGRAVNLALQLQLSFPGTLLISPSTSSVQLTDDLEPEGGDDLEPAVRSRNNSAIHIR
VYRPQGE
NT seq 384 nt NT seq  +upstreamnt  +downstreamnt
atggcggagcagcagccattttgtgggcgggtccatcacactcgtcgccccgcccctcgg
ccgcctcggagccccaatgacatttacgtgaatacaaagagtgatttccgggctcagttg
gctcggtgccggcagcttgtcagtagcggggacttcagggaagtgagggtccatggtttg
ggtctggccatcggacgtgccgttaacttggctctgcagctgcagttgtccttccccggg
actctgctcatctcccccagcacctcctccgtacaactcaccgacgatctggaacctgag
ggcggagacgacttggaacctgcagtccggagccgcaacaactccgccattcacatccgt
gtgtatcggccgcagggggagtga

  All links  
No link information was found.   
DBGET integrated database retrieval system