KEGG   Xenopus laevis (African clawed frog): 447726Help
Entry
447726            CDS       T01010                                 

Definition
MGC81861 protein
Orthology
K03354  
anaphase-promoting complex subunit 7
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
Cell cycle
Oocyte meiosis
Ubiquitin mediated proteolysis
Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:xla00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    447726
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    447726
   04114 Oocyte meiosis
    447726
 Organismal Systems
  Endocrine system
   04914 Progesterone-mediated oocyte maturation
    447726
Ubiquitin system [BR:xla04121]
 Ubiquitin ligases (E3)
  multi subunit Ring-finger type E3
   APC/C
    other subunits
     447726
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 565 aa AA seqDB search
MNVIDHVRDMAAAGLHSNVRLLSSLLLTMSNNNSEMLSPSQKYQLLVYHADSLFHDKEYR
NAVSKYTMALQQKKTLTKTSKVRPAMGNSAATPQNQSLPSEIEVKYKMADCYTMLKQDKD
AIAILDGIPSRQRTPKINMMLANLYKKAGQERSAVTSYKEVLRQCPLALDAILGLLSLSV
KGAEVASMTLNVIQSIPNLDWLSAWIKAYAFVHTGDNTRAINTICSLEKKSLLRDNVDLL
GTLADLYFRVGDNKNAILKFEQAQMLDPYLIKGMDIYGYLLAREGRLEDVENLGCRLFNI
SDQHAEPWVVSGCHSFYTKRHSRALYLGAKAIQLNSNSVQALLLKGAALRNMGRVQEAII
HFREAIRLAPCRLDCCEGLIECYLASSSVREAMVMANNVYKTLGANAQTLTLLATVCLED
PVTQEKAKTLLDKALVQRPDYIKAVVKKAELLSRELKYEEGIALLRNTLANQSDCVLHRM
LGDFLVVVNEFQEAMDQYSIALSLDPNDQKSLEGMQKMEKEESPTDATQEEDVDDMEGSG
EEGDLEGSDSEAAQWADQEPWFAMQ
NT seq 1698 nt NT seq  +upstreamnt  +downstreamnt
atgaatgtgatagatcatgtgcgggacatggcagcggccgggctccattctaatgtgcgc
ttactgagcagtctcctactgactatgagcaacaacaactcggagatgttgtctccatca
caaaagtaccagttgcttgtgtaccatgcggactctctgttccatgacaaagaatacaga
aatgctgtcagcaagtatacaatggctctgcagcagaagaaaaccttaaccaagacttcc
aaagttaggccagcaatgggaaattcagctgctaccccacaaaatcagagtctcccatca
gagattgaggtgaaatataaaatggctgactgttataccatgctgaaacaggacaaggat
gccatagccattttagatggaattccttctcggcagagaaccccaaagattaacatgatg
ttggctaatttgtacaagaaagctggacaggaacgttctgcagtaaccagttacaaggag
gttctgagacagtgccctctggcgcttgatgccatactaggattgctatccctttctgta
aagggagcagaagttgcatctatgactctcaatgtcatccagagtattcccaacctagac
tggctttctgcctggatcaaagcctatgcgtttgtgcacactggagacaacaccagagct
atcaacaccatctgttctctagaaaagaaatctttactaagggacaatgtagatcttctg
gggactttggcggatttgtatttccgtgttggtgacaataaaaatgccattcttaagttt
gagcaagctcagatgctggatccctatctaataaaaggaatggatatatatgggtacttg
ctggctcgtgaaggtcgactggaagatgtagagaatctcggatgccgcttgtttaatata
tctgatcaacatgctgagccgtgggtagtttctgggtgccacagcttttataccaagaga
cactccagagccctgtatttgggagctaaggctatccagttgaacagcaatagcgttcag
gccttactgcttaagggggcggcattaagaaacatggggagggtgcaggaagcaataata
catttccgagaagcaattcgattggcaccttgtcgactcgactgctgtgaaggtctcatt
gaatgctatttggcatccagcagtgtacgggaagctatggtgatggccaacaatgtctac
aaaacccttggagccaatgcacaaactctaactctgctggcaactgtgtgcctggaagac
cctgttacccaagagaaagcaaaaaccttgttagacaaagctctcgttcagagaccggat
tatataaaggctgtggtgaagaaagcagagttactcagtcgagagctgaagtatgaggag
ggaattgccttgctccgtaatacccttgcaaaccagagtgactgtgtattacatcggatg
ctaggagattttcttgtggtagttaatgagtttcaggaggctatggaccagtacagcatt
gccctcagtttggatccaaatgaccaaaaatccttggaaggaatgcagaaaatggagaag
gaagagagccctacagatgccacacaggaagaagatgttgatgatatggaggggagtgga
gaagaaggagatctagagggcagtgatagtgaagctgctcagtgggcagatcaggagcca
tggtttgcaatgcagtga

DBGET integrated database retrieval system