KEGG   Xenopus laevis (African clawed frog): 447733Help
Entry
447733            CDS       T01010                                 

Gene name
usp14
Definition
(RefSeq) ubiquitin specific peptidase 14 (tRNA-guanine transglycosylase) (EC:3.1.2.15)
  KO
K11843  
ubiquitin carboxyl-terminal hydrolase 14 [EC:3.4.19.12]
Organism
xla  Xenopus laevis (African clawed frog)
Brite
Enzymes [BR:xla01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     447733 (usp14)
Peptidases [BR:xla01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   447733 (usp14)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
AA seq 489 aa AA seqDB search
MPLYSVNVKWGKEKFDNVELNTDEPPMVFKAQLFALTGVQPDRQKVMVKGGTLKDDDWGN
LKIKSGMTLLMMGSAEALPEEPAVRPVFVEDMTEEQLASAMELPCGLTNLGNTCYMNATV
QCIRSVPELKEALKRYTGALRASGEMASAQYITAALRDLFDSMDKTSSSIPPIILLQFLH
MAFPQFAEKGDQGQYLQQDANECWVQVMRVLQQKLESTEGDSDMETDSGAAATASKKNSF
IDQFFGIEFESTMKCTESEEEEVTKSKETQLQLSCFINQEVKYLFTGLKLRLQEEITKFS
PSLQRNALYNKTSRISRLPAYLTIQMVRFFYKEKESVNAKVLKDVKFPLMLDIYELCTPD
LQEKMVPYRSKFKQVEDKVPEQAPKAKQMAQREVRYEPYAFPGDVGSINCGYYELQAVLT
HQGRSSSSGHYLSWVKRKHDEWIKFDDDKVSIVSPEDILRLSGGGDWHIAYVLLYGPRRI
EASDEETDQ
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
atgcccctgtactcagtgaacgtcaaatggggaaaggagaagtttgacaatgtggaactg
aacactgatgaaccccccatggttttcaaagcgcagctgtttgcactgactggagtgcag
ccagatagacaaaaggttatggtaaaaggaggaacattaaaggatgatgactggggaaac
ttaaaaataaagtctggcatgaccttattaatgatgggatctgctgaagctctgccagag
gaacctgcagtaagacctgtttttgtagaagacatgacagaagagcagctggcttctgct
atggagttaccttgtggcttaacaaaccttggtaacacatgttacatgaatgctactgtt
cagtgtatccgatctgttccagagctgaaggaagcactcaaaaggtatacgggtgccttg
agagcttcaggtgaaatggcctctgcccagtatattactgcagctcttagagatttgttt
gactctatggataaaacgtcatccagtatcccaccaatcatcctcctccagtttctacac
atggctttcccgcagtttgctgagaaaggggatcaagggcagtatcttcaacaggatgct
aatgaatgctgggtgcaagtaatgagagtgctgcagcagaagttagaatcaacagaagga
gattctgatatggagacagattcaggagcagctgcaacagcctcaaagaaaaatagcttc
atcgatcagttttttggcatcgagtttgagtcaaccatgaaatgtactgaatctgaagaa
gaggaagttactaaaagtaaagagacccagttgcagcttagctgttttattaaccaggaa
gtgaaatatctcttcactggcctcaaattgcgccttcaagaagaaatcacaaaattttct
ccatcgttgcaaagaaatgctctgtataacaaaacttccaggatcagtcgtttacctgcc
tacctgactatccagatggtccgattcttttacaaagagaaggaatctgtgaatgccaaa
gttcttaaggatgtgaaatttcctctgatgttggacatatatgaattatgtacaccggat
ctccaagaaaagatggttccatatcgttccaaattcaagcaagtagaagataaagttcca
gagcaagcacccaaagcaaagcaaatggcccagagagaagttcggtatgaaccttatgcc
tttccaggtgatgttggctcaattaattgtggttactatgagctgcaggcagttctaact
catcaaggaagatcaagttcttcaggacactacttatcctgggtaaagagaaaacacgat
gaatggattaaatttgacgacgacaaagtaagcattgtgtctcctgaagatattctgcga
ttatctggagggggagattggcacatagcttatgtccttctttacggacctcgacgaatc
gaagctagcgatgaagagaccgaccaatga

DBGET integrated database retrieval system