KEGG   Xenopus laevis (African clawed frog): 447734Help
Entry
447734            CDS       T01010                                 

Gene name
hat1
Definition
histone acetyltransferase 1 (EC:2.3.1.48)
Orthology
K11303  
histone acetyltransferase 1 [EC:2.3.1.48]
Organism
xla  Xenopus laevis (African clawed frog)
Brite
Enzymes [BR:xla01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     447734 (hat1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
AA seq 402 aa AA seqDB search
MEKKLAEYKCNTNEAIQLKLVRFPEDIEDESMTFNPEYSHQIFGDEEVAFGYKGLKILLY
YSAGNLSTMFRVQYSSKVNDKFDLVQPDDVENKIHELIPAGFCSGTDDFITLLEKEVNFK
PFGTIVHTYTVHNEDAGEDISYQIYKADMTSPGFREYHERLQTFMMWFIETASYIDVDDE
KWDYFLVFEKYNKDGATLFATVGYMTVYNYYVYPDKTRPRVSQMLVLPPFQGEGHGAQLM
ETVHRYYVSAPNILDITAEDPSENFVRLRDFVLVKLCQNLPCFSPEKLLCGFSKEMVTEA
QEKLKINKKHARRVYEILRLRATDMSDPEKSKAYRLDVKKRLVGPYKKNQREMAKMQQCL
RPEELTNQMNQIDLNTQHEQLEESYQQLVEEYRRIVERLAQA
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atggaaaagaaattggctgagtacaaatgtaacacaaatgaagcaatacaactgaaatta
gtgcgctttccagaagacattgaagatgagagcatgacatttaacccagagtacagccac
cagatttttggtgatgaagaggtggcctttggatacaaaggcttgaagatcctgttgtac
tacagtgctgggaacttatctactatgtttcgggtgcagtacagctctaaagttaacgat
aagtttgatttggttcagccagatgatgttgaaaataaaatccatgaactaattcctgca
ggtttctgcagtggtaccgatgattttataactttgttggaaaaggaggtgaattttaaa
ccctttggaaccattgttcatacttacactgttcacaatgaagatgctggcgaagatatc
tcatatcagatatacaaggctgacatgacgagtccaggctttcgagagtaccatgaaaga
ctccaaaccttcatgatgtggtttattgaaactgctagctatatagatgtagatgacgag
aaatgggactactttctagtatttgagaagtataataaggatggagctacactctttgca
accgtaggctacatgacagtctataattactatgtgtacccagacaaaacccggccacgt
gtaagccagatgttggttttgccaccatttcaaggggaaggtcacggtgcccagcttatg
gaaacagttcacagatattatgtatctgctcccaatattttggacatcacagctgaagat
ccgtcagaaaactttgttcgtctcagagactttgtccttgtgaagctttgtcaaaacctt
ccatgcttttctcctgaaaaacttttgtgtggattcagcaaagagatggtgacagaggct
caagaaaaactcaagattaacaagaaacatgcaaggcgagtttatgaaattcttcggtta
cgagcaacagacatgagtgatcctgagaaatccaaagcatacagactggatgtaaaaaaa
agacttgtggggccatacaagaaaaatcagagagaaatggctaagatgcaacagtgcctc
cggccagaagagttgaccaaccagatgaaccaaatcgatctaaacacacagcacgagcag
ttagaggagagctatcagcagcttgtcgaggaatacaggcggatagttgaacggcttgct
caggcctag

DBGET integrated database retrieval system