KEGG   Xenopus laevis (African clawed frog): 447764Help
Entry
447764            CDS       T01010                                 

Gene name
mgll.L, mgll
Definition
(RefSeq) monoglyceride lipase L homeolog
  KO
K01054  
acylglycerol lipase [EC:3.1.1.23]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
Glycerolipid metabolism
Metabolic pathways
Module
Acylglycerol degradation
Brite
KEGG Orthology (KO) [BR:xla00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    447764 (mgll.L)
Enzymes [BR:xla01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     447764 (mgll.L)
Peptidases [BR:xla01002]
 Serine Peptidases
  Family S33
   447764 (mgll.L)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Xenbase: 
Position
4L
AA seq 309 aa AA seqDB search
MPEGSTPALSPQGVPYAELSHYINADGQHIFSRYWKPSGSPRALMFIVHGAGEHCCRYDD
LAQILTALNFLVFSHDHVGHGQSEGERMTIHDFHIFVRDNIQHLDLMKKQYPDLPIFMCG
HSMGGAIAILTVDERPDDFSGLILISPLVLPSPQSATSFKVFAAKLLNYVLPNLSLGSID
PSFVSRNKKEIEAYTTDPLVYHGGMKVSFGVQLLNATSRVEKALPLFKVPVLLFHGTLDK
LCDIRGSHVMIDTIQSEEKTLKVYEGAFHALHKELPEVTSSVFQEIESWLQQKLGGTGSS
NMVQQAPST
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgcctgaaggtagcaccccagctctcagtcctcagggggtcccatacgcagaattgagc
cattacattaatgcagatggacaacacattttctccagatactggaagccttcaggttca
ccaagggctctgatgtttattgtacatggtgctggggaacactgctgccgatatgatgac
ctggcacagattctaactgctctgaactttctggtcttttcccatgaccatgttggccat
gggcagagtgagggggagcgaatgaccatccatgatttccatatctttgtaagagacaac
atacaacacttggacctcatgaagaaacaatacccggacctgccaatttttatgtgtgga
cattccatgggaggagctattgccatcctgactgttgatgagagaccggacgacttttct
ggattaatcctaatatctcccttggtgttgccaagcccacaatctgcgacatcattcaag
gtttttgcagctaaactgctgaactatgtcctcccgaacctttccttgggcagtattgat
ccaagcttcgtatctcgcaataagaaagagattgaggcctataccacagacccattggtt
taccatggaggaatgaaggtttcctttggtgttcagttgctaaatgccacatctcgggtg
gagaaagccctcccgctctttaaggttccggtcctgctgtttcatggaactttggacaag
ttgtgtgatattcgtggttcccacgttatgatagacactatacaaagtgaggagaagaca
ttaaaggtatatgaaggagctttccatgctttgcataaagagctgccagaggtcacctct
tctgtattccaagagattgagagctggctccagcagaaattggggggcacgggaagcagc
aacatggtgcagcaagcacccagcacatag

DBGET integrated database retrieval system