KEGG   Xenopus laevis (African clawed frog): 447767Help
Entry
447767            CDS       T01010                                 

Definition
MGC84250 protein
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Metabolic pathways
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Class
Metabolism; Overview; Carbon metabolism [PATH:xla01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:xla01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:xla00010]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:xla00260]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 253 aa AA seqDB search
MPHRLVIVRHGESSWNQENRFCGWFDADLSEKGTEEARRGAQAIKEAGMEFDICYTSVLK
RAVRTLWYIMDGIDQMWLPVVRTWRLNERHYGGLTGLNKAETAEKHGEEQVKIWRRSYDI
PPPVMGEDHPYYKLISKDRRYKDLSAKELPSCESLKDTIARALPFWNDVIAPQILAGKRV
LIAAHGNSLRGIVKHLDGMSDAAIMELNLPTGIPIVYELDDNLKPTKPMSFLGDEETVRK
AMEAVAAQGKVKK
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgcctcaccgcctagtcattgtacgccacggggaaagctcatggaatcaggagaacagg
ttctgtggctggtttgatgccgacctgagtgagaaagggacagaggaggcccgcagaggt
gctcaggcaataaaggaggccgggatggagtttgacatctgctacacctcagtgctgaag
agggcggtgcgtactctgtggtacatcatggatggaatagaccaaatgtggctgccagtg
gtcaggacctggagactgaatgagcgccactatgggggactgacgggcctcaacaaggca
gagactgcggagaaacatggggaagagcaggtgaagatctggaggcgatcttatgacatc
ccaccaccagtcatgggagaagatcacccctactacaagctgataagtaaggatcggcgt
tacaaagatctcagcgccaaagagctgccctcctgtgagagtctgaaggacaccattgcc
cgtgccctacccttttggaacgatgtgattgccccccagatcctggctggaaagcgggta
ctgatcgcagcacatggaaacagcttgagaggcattgtcaagcacctggatgggatgtct
gatgctgccatcatggaactcaatctccccactggaattcccattgtgtatgaacttgat
gataacctgaagccaaccaaacccatgagctttcttggggacgaggaaactgtacggaaa
gctatggaggcagtggcagcccagggaaaggtcaaaaaatag

DBGET integrated database retrieval system