KEGG   Xenopus laevis (African clawed frog): 494689Help
Entry
494689            CDS       T01010                                 

Definition
uncharacterized LOC494689
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:xla00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    494689
  Metabolism of other amino acids
   00480 Glutathione metabolism
    494689
Enzymes [BR:xla01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     494689
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 184 aa AA seqDB search
MYLAALVLLLLLPPSLQKSRDFYTFKVVNIRGKLVSLEKYRGSVTLVVNVASECGFTDSH
YKALQQLQRDLGSHHFNVLAFPCNQFGQQEPNSDREIENFVRKNYSASFPMFSKTAVTGS
GANTAFKYLIESSGKEPDWNFWKYLVGPEGKVVDAWGPTVSVAEVRPHITSLVRNIILKK
KDEL
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
atgtaccttgcggctcttgttttgcttctcttgttgcccccctcactccagaaatcccgg
gatttctacacctttaaggtggtaaatatcaggggcaagctggtgtcgctggagaaatac
cgtgggtcggtgactctggtggtgaatgtagcaagtgaatgtggatttacagattcccac
tacaaagcactgcagcagctgcagagggacctgggatctcaccacttcaatgttttggca
tttccatgcaaccagtttggacagcaagaaccaaatagcgaccgagaaattgagaacttt
gtcagaaagaattacagtgcatccttccccatgttcagtaaaactgcagtcactggctct
ggtgccaatactgccttcaagtacctaatagaatcctctggaaaagaaccggactggaac
ttctggaaatacttagttgggccggagggtaaagtagttgatgcttggggtccaacagtc
tctgtagcagaagtgaggcctcacatcaccagtcttgtgaggaatataattctgaaaaag
aaagatgaactttga

DBGET integrated database retrieval system