KEGG   Xenopus laevis (African clawed frog): 494714Help
Entry
494714            CDS       T01010                                 

Gene name
otud5-b, DUBA
Definition
OTU domain-containing protein 5-B (EC:3.4.19.12)
Orthology
K12655  
OTU domain-containing protein 5 [EC:3.4.19.12]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
RIG-I-like receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:xla00001]
 Organismal Systems
  Immune system
   04622 RIG-I-like receptor signaling pathway
    494714 (otud5-b)
Enzymes [BR:xla01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     494714 (otud5-b)
Peptidases [BR:xla01002]
 Cysteine Peptidases
  Family C85: DUBA deubiquitinylating enzyme
   494714 (otud5-b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 518 aa AA seqDB search
MTILPKKKPPPSSDPEGNGERSGSGAPDSHSRSGARPRSSPPPRWAYPGNPSSAAERHTQ
QVSPPPGSATSGGAGPLGDGAPASSSSSSSSSCNGAGAGGCCSGPGHSKRRRQVLSAGPG
ATGNCPDTDDGAGNNSEDEYETAAQTQHLDPDTAQQQEHWFEKALCEKKGFIIKQMKEDG
ACLFRAVADQVYGDQDMHEVVRKHCMDYLMKNADYFSNYVTEDFTTYINRKRKNNCHGNH
IEMQAMAEMYNRPVEVYQYGTEPINTFHGIQQNEDEPIRVSYHRNIHYNSVVNPNKATIG
VGLGLPSFKPGHAEQSLMKSAIRTSEESWIEQQMLEDKKRATDWEATNEAIEEQVARESY
LQWLRDQEKQARQPRKASATCSSATAAACSGLEEWSGRSPRQRSTAGSPEQPDVHAELCM
KPPSPGAALTLGKPPSPCAPGPSNQMSAGADRATSPLVSLYPALECRAIMQHMSPTAFGL
KDWDDDEILASVLAASQQEYLDTMKKSTLRRESSPDHS
NT seq 1557 nt NT seq  +upstreamnt  +downstreamnt
atgacgattctgcccaagaagaagccgcctccctcctcggatcccgagggaaatggggag
cggagcggctcgggggcacctgactcgcactctcgctccggggcccgaccccgctcctcc
ccgcccccgcgctgggcctaccccgggaacccctcatccgccgccgagcgacacactcag
caagtgtctcctcccccgggcagcgccacgtctggcggagccggacccttgggagacgga
gctccggcctcgtcgtcttcttcttcttcctcttcttgtaacggcgcgggggcgggcggc
tgctgctcggggcctgggcacagtaagaggaggagacaggtgctgagcgcggggcccggg
gctaccggaaactgcccggatacagacgatggagccggaaacaacagcgaggatgagtat
gagactgcggcccaaacacaacacttggaccccgacactgctcagcagcaggagcactgg
tttgagaaggcgctgtgtgagaagaagggatttatcatcaaacagatgaaggaggatgga
gcctgtctgttcagagctgtggcggatcaggtgtatggagaccaggatatgcacgaggtt
gtgcgcaagcattgcatggattacttgatgaagaacgccgactacttctcaaattatgtg
accgaagattttaccacctacatcaaccgcaaacggaaaaacaattgtcacggcaaccac
attgagatgcaggccatggccgagatgtacaatcggccggtggaggtgtatcagtacgga
acagaaccaatcaacacatttcatggcattcagcaaaatgaagatgaaccaatcagagtg
agttaccatcggaacatacactacaactctgtggtgaaccctaacaaggccaccattggt
gtggggctaggcctgccctccttcaaacctgggcatgcagagcagtccctcatgaagagc
gccatcagaacctccgaggagtcctggatagagcaacagatgttggaggacaagaaaagg
gccaccgactgggaggccaccaatgaggccatagaggagcaagtggcccgggagtcctac
ctgcagtggctacgggaccaggagaaacaagccagacagccacgcaaagcaagtgcaaca
tgcagttctgcaactgcggcagcatgcagtgggctggaggaatggagcggccgatcccca
aggcagcgcagtacagcagggtcccctgagcagccagacgtgcatgcagaactgtgtatg
aagccgccatccccaggggccgccctcacgttaggcaagccgccgtccccttgcgcccca
ggccctagcaaccagatgagcgcaggagctgaccgagccacgtccccgcttgtgtccttg
tacccggccctggaatgcagagcaatcatgcagcacatgtcgcccacagcgtttgggctg
aaggattgggacgacgatgaaattcttgcgtccgtattagccgcatcccagcaggaatac
ctggacaccatgaagaagagcaccctgagaagagagtcctccccggatcacagctga

DBGET integrated database retrieval system