KEGG   Xenopus laevis (African clawed frog): 494745Help
Entry
494745            CDS       T01010                                 

Definition
uncharacterized LOC494745
Orthology
K12077  
pyruvate dehydrogenase kinase isoform 1 [EC:2.7.11.2]
Organism
xla  Xenopus laevis (African clawed frog)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 412 aa AA seqDB search
MRLLRALMKSAPLSSSSTTSQVDFYSKFSPSPLSMKQFLDFGSVNACEKTSFIFLRHELP
VRLANIMKEINLLPDNLLKMPSIRLVQSWYVQSFQEIIDFKDTNTEDPNTVRKFSDTVIT
IRNRHNDVIPTMAQGVVEYKDSFGVDPVTSQNVQYFLDRFYMSRISIRMLLNQHTLLFGG
KVKVNPAHPKHIGSIDPTCNVVDVVKDGYENAKHLCDLYYMSSPELELTEFNAKSQGQPI
QVVYVPSHLYHMVFELFKNAMRATMEFQADKGVYPPIKVHVALGSEDLSVKLSDRGGGVP
LRKIERLFNYMYSTAPLPRMETSRATPLAGFGYGLPISRLYAKYFQGDLKLYSLEGYGTD
AVIYFKALSTESVERLPVYNKSAWKHYKTNHEADDWCVPSSEPKDMTTFRSN
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
atgaggctactcagggctttgatgaaaagcgcccccttatccagcagcagtaccacgagt
caggtggacttctactccaagttttcgccgtcccccctgtccatgaaacagttcctggat
ttcggttcagtgaatgcgtgtgaaaagacctcatttatatttctgaggcatgaattgcca
gtacgattagcaaacatcatgaaagagataaatttgcttccagacaacctcttgaagatg
ccatccattaggctggttcagagctggtatgttcagagcttccaagaaataattgatttc
aaggacaccaatacagaggacccaaatacagtccgaaaattctcagacacagtgatcacc
atcaggaatcggcacaatgatgtcatcccaactatggctcagggagtggttgaatataaa
gatagttttggggtcgatccagtaacttctcagaatgtgcagtattttttagaccgcttt
tacatgagtcgcatatcaattagaatgctgctaaatcaacacactttgctctttggaggg
aaagtgaaagtgaatccagcacatccgaagcacatcggcagcattgacccaacatgcaac
gttgtcgacgttgttaaagatggatatgaaaatgcaaaacatctgtgtgatttatattac
atgagctctccggaattagagctaaccgagttcaatgctaaatctcaaggacagcccatt
caagtggtgtatgtaccatctcatctctaccacatggtgtttgaacttttcaagaatgca
atgagagccaccatggaattccaggcagacaaaggagtctatcctcctatcaaagtgcat
gtggctttgggcagtgaggatttatcagttaagctcagtgatcgaggtggaggagtccct
ttaaggaaaatcgagcgattgttcaattacatgtattctactgcacctctgcctcgaatg
gagacatcccgcgcaaccccattggccgggtttggatatggcttgccaatatctcgcctc
tatgccaagtattttcaaggagacttgaagttatattcattggagggatatgggacagat
gctgttatatacttcaaggctttatcaacggagtcagtggagaggcttccggtgtacaac
aaatctgcctggaaacattacaagaccaaccatgaagcagacgattggtgcgtccctagc
agtgagcccaaggacatgaccacctttcgcagcaactga

DBGET integrated database retrieval system