KEGG   Xenopus laevis (African clawed frog): 494987Help
Entry
494987            CDS       T01010                                 

Definition
uncharacterized LOC494987
Orthology
K00893  
deoxycitidine kinase [EC:2.7.1.74]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:xla00230]
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:xla00240]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 263 aa AA seqDB search
MATPPKRICIDVPASPSGNKCKRISIEGNIAAGKSTFVNILKKANEEWDVVPEPIARWCN
IQSCKDEFEELTTSQKSGGNLLQMMYEKPERWSFTFQSYACLSRIRAQLKALGGKLKEAE
NPVLFFERSVYSDRYIFASNLYEAECMNETEWTVYQDWHDWMNSQFGADLELDGIIYLRA
IPEKCLNRVYTRGREEEQGIPMEYLEKLHYKHETWLHHRTLRTDFEYLQEIPILTLDVNE
DFRDNKQKQESLIEKVKEFLSTL
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atggccactccaccgaaaaggatttgcatcgacgtgccagcatccccctcaggcaacaag
tgcaagaggatctccatagagggaaacattgctgcagggaaatctacctttgtcaatatt
ctcaaaaaggccaatgaagagtgggatgttgttcctgagcccatagcaagatggtgcaat
attcagagctgtaaagatgaatttgaggagctaactacctctcagaaaagtggaggtaat
ctactccagatgatgtatgaaaagccagagcgctggtctttcacttttcagtcctatgct
tgtctgagccgtatcagggcccagctgaaagctttgggagggaagctgaaagaagcagaa
aatccagtgctcttctttgaacgctccgtctatagtgacaggtatatctttgcatccaat
ttgtatgaggcagagtgcatgaatgaaactgaatggactgtttaccaggattggcatgat
tggatgaattctcagttcggggcagatcttgaactggatggaattatttatcttcgcgct
atccctgagaaatgtttaaacagggtttacacccgtgggcgggaagaagagcaaggaatt
cccatggaatacttggaaaagcttcattacaagcacgagacatggcttcatcacagaact
ctgagaacggattttgagtacctgcaagaaatccccatcctgactttagatgtaaatgaa
gatttcagagataataaacagaagcaagagagtcttattgaaaaggtgaaagaatttctg
agcactttatag

DBGET integrated database retrieval system