KEGG   Xenopus laevis (African clawed frog): 494987Help
Entry
494987            CDS       T01010                                 

Definition
(RefSeq) uncharacterized LOC494987
  KO
K00893  deoxycitidine kinase [EC:2.7.1.74]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla00230  Purine metabolism
xla00240  Pyrimidine metabolism
xla01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xla00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    494987
   00240 Pyrimidine metabolism
    494987
Enzymes [BR:xla01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.74  deoxycytidine kinase
     494987
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: dNK AAA_18 AAA_28 Thymidylate_kin AAA_33
Motif
Other DBs
NCBI-GeneID: 494987
NCBI-ProteinID: NP_001088163
UniProt: Q5XHI7
Position
1L
AA seq 263 aa AA seqDB search
MATPPKRICIDVPASPSGNKCKRISIEGNIAAGKSTFVNILKKANEEWDVVPEPIARWCN
IQSCKDEFEELTTSQKSGGNLLQMMYEKPERWSFTFQSYACLSRIRAQLKALGGKLKEAE
NPVLFFERSVYSDRYIFASNLYEAECMNETEWTVYQDWHDWMNSQFGADLELDGIIYLRA
IPEKCLNRVYTRGREEEQGIPMEYLEKLHYKHETWLHHRTLRTDFEYLQEIPILTLDVNE
DFRDNKQKQESLIEKVKEFLSTL
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atggccactccaccgaaaaggatttgcatcgacgtgccagcatccccctcaggcaacaag
tgcaagaggatctccatagagggaaacattgctgcagggaaatctacctttgtcaatatt
ctcaaaaaggccaatgaagagtgggatgttgttcctgagcccatagcaagatggtgcaat
attcagagctgtaaagatgaatttgaggagctaactacctctcagaaaagtggaggtaat
ctactccagatgatgtatgaaaagccagagcgctggtctttcacttttcagtcctatgct
tgtctgagccgtatcagggcccagctgaaagctttgggagggaagctgaaagaagcagaa
aatccagtgctcttctttgaacgctccgtctatagtgacaggtatatctttgcatccaat
ttgtatgaggcagagtgcatgaatgaaactgaatggactgtttaccaggattggcatgat
tggatgaattctcagttcggggcagatcttgaactggatggaattatttatcttcgcgct
atccctgagaaatgtttaaacagggtttacacccgtgggcgggaagaagagcaaggaatt
cccatggaatacttggaaaagcttcattacaagcacgagacatggcttcatcacagaact
ctgagaacggattttgagtacctgcaagaaatccccatcctgactttagatgtaaatgaa
gatttcagagataataaacagaagcaagagagtcttattgaaaaggtgaaagaatttctg
agcactttatag

DBGET integrated database retrieval system