KEGG   Xenopus laevis (African clawed frog): 494988Help
Entry
494988            CDS       T01010                                 

Gene name
lamb2.L, lamb1, lamb2, lams
Definition
(RefSeq) laminin subunit beta 2 L homeolog
  KO
K06243  
laminin, beta 2
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
Focal adhesion
ECM-receptor interaction
Brite
KEGG Orthology (KO) [BR:xla00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    494988 (lamb2.L)
 Cellular Processes
  Cellular community - eukaryotes
   04510 Focal adhesion
    494988 (lamb2.L)
Cell adhesion molecules and their ligands [BR:xla04516]
 1. Immunoglobulin Superfamily
  Others
   LU; Lutheran blood group glycoprotein [KO:K06578]
    Laminin-11 Extracellular matrix (ECM) components
     494988 (lamb2.L)
    Laminin-14 Extracellular matrix (ECM) components
     494988 (lamb2.L)
 2. Integrin Family
  Beta1 integrins
   VLA-3
    ITGB1; integrin beta 1 [KO:K05719]
     Laminin-11 Extracellular matrix (ECM) components
      494988 (lamb2.L)
   VLA-6
      494988 (lamb2.L)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
Position
4L
AA seq 1783 aa AA seqDB search
MAPSLWPFGLVITALVTGSVSQIPDQQHGCSQGSCYPATGDLLVGRADKLKATSTCGLRR
AQPYCIVSHLQDEKKCFVCDSRKPYNPLYNPISHRIENVITTFAPQRKKAWWQSENGVSE
VTIQLDLEAEFHFTHLIMTFKTFRPAAMLVERSADFGRTWQIYRYFAHDCTSSFPNVSRN
TLRKVDDVICESRYSDIEPSTEGEVIYRVLDPAIPIRDPYGPNIQNLLKITNLRINFTKL
HTLGDNLLDSRVEIKEKYYYALYELVVRGNCFCYGHASECAPIEGLSRDFEGMVHGRCVC
KHNTKGLNCEQCDSFFNDLPWRPAEGRSTNACKKCNCNNHSRKCHFDMAVYLSTGNVSGG
VCDDCVHNTMGRNCEFCKPFFYKDPSKDIRDSAVCKDCDCDPDGSLDGGLCDAQDSPALG
LIAGQCRCKDYAEGPRCDRCKTGFFGLSANNFQGCQRCQCDPRGTISGGAQCDPISGDCF
CKRFVTGRTCNQCLPEFWALSHDLHGCRSCDCDVGGAWDNHCAMETGQCRCRSHMVGRQC
NQVKSGYYRIHLDHYTYEAESAVHRQGCSVLERERPIGRQATWTGPGFALVPEGGILEFQ
ISNIPYSMEYDVIIRYEPQLSAMWEQVKISIIRPGPIPTSSPCGNTIPADDQMVASLPPG
TRHVVLPQPVCLERGVSYTIRLEFSRYSSRERVPGASILVDSLVLAPRYSAMEMFIAGDP
ASIQRKDTFERYRCHSNSGNVIKSPTTEVCSGLITSMSAVIHEGALPCSCDPQGSLSSEC
DPNGGQCQCKTNVIGQRCDRCAPGTYGFGPTGCRVCECNKEGSSQNFCDQRTGQCPCRQG
AFGSRCDRCQPGHWGFPNCRQCQCNSHSEECDQRTGACLNCRDHSTGDRCERCIAGFFGN
PVLGSGDHCRPCPCPEGPTSGRHFAASCQQDPRSRQVICNCKQGYSGVRCDECSPGFFGN
PFQTGGRCLLCQCNNNIDMTDIGACDRRSGQCLKCKFNTEGRFCEHCRIGFYGDASRHNC
RKCACNYLGTEPSQCPSREDCMCDRTSGQCHCLPNVMGQNCDRCSPNFWNLASGKGCQPC
NCDPNHSFSLACNEFTGKCQCRPGFGGLTCTDCQENYWGNPNIQCRACDCDRRGIKAAQC
NRATGHCSCRAGVSGVRCDQCARGFSGQFPDCQPCHQCFGDWDRIVQDLATRTKSLVQRG
KDIQLSGIAGVYQKNFRDIEKKLAKARAIVIARNATVESVTQLMKIMDDLRNKINESTEA
LTQLEVELTTVQDENFDANHDLAELERNARSLNMTAKERSHQLDVLKNSNFLGAYDSIQQ
SHAKSRQAEKQANNATTNVPSPVSHSARTREKAQQLITHKRDDFNRKNAANRRALNDLAA
KTDTLDMKKINEKVCGAPGDAPCSESPCGGAGCRDDEGNRHCGGLNCNGAVATADNALGR
ARHAEEELQKALGEVEVLFRKVAEAKVKADRAKQRAQATLDRANETKARVEQSNKELREL
IQQIKDFLNQEGADPDSIEMVASRVLDLTIPATPKQIQRLAEEIKDRVKTLANVDAILDQ
TTADVRKAEQLLHEAKRAKNRAENVKNTAESVKKALDDARRAQNAAEGAIRTANNDIKDT
ERKLTAIQTTTSSAENYLNDAMDRVGNLDKQIDALKMKRANNSLAASRAEESATVALDKA
NDAKKILEGQLADKYKTVQNVVDRKAKNIKDAKTKADQLQDEAKKLLDNAQDKLKRLQDL
EVEYTKNEKLLQDKAKQLNGLEDKMKEILHGINQQIQIYNTCQ
NT seq 5352 nt NT seq  +upstreamnt  +downstreamnt
atggcgccgtccttgtggccatttggccttgtgataactgccttggtcacaggatccgtt
tcccagattcctgaccagcaacatggatgttcccaaggaagctgctaccctgccactgga
gacttgctggtgggccgagcagataaactcaaagctacatcaacctgtggccttcggaga
gctcagccatactgtatagtcagccatttgcaggatgaaaagaaatgctttgtctgtgac
tctcgcaaaccctacaaccccttgtataaccccatcagccaccgcattgaaaacgtcatt
acgacttttgctcctcaacggaaaaaggcatggtggcagtctgaaaatggagtttctgag
gtcactattcagctagatctggaggctgaatttcacttcacccacctgatcatgaccttc
aagaccttcaggccggcggctatgctggtggaacgctctgcagactttgggcgcacctgg
caaatttaccgttactttgcacatgactgtacctcctctttcccaaacgtgtcccgcaac
accctgaggaaggtggacgacgttatctgtgaatcccgttactcagacattgagccctcc
acggaaggagaggtcatttacagagttttggatccagccatcccgatccgagacccatat
ggtccaaatattcaaaacctcttgaagatcaccaacctccgaatcaactttaccaagctg
cacacattgggtgacaacctcctggattcccgcgtggagatcaaagagaagtattactat
gccctctatgagctggtggtgcgagggaactgcttctgctacggccatgcttccgaatgt
gcgcccatcgaaggattgtccagagatttcgagggcatggtgcatggaagatgcgtgtgc
aaacacaacaccaaggggctcaattgtgagcaatgtgatagtttctttaatgaccttccc
tggagaccagcagaaggacgcagcaccaatgcctgtaaaaagtgcaactgcaacaatcac
tctcgcaagtgtcactttgacatggctgtgtacctgtctaccgggaatgtcagtggtggg
gtgtgtgacgactgtgtgcacaacaccatgggccgtaactgtgaattctgcaagccattc
ttctacaaggatccaagcaaggacattcgggacagtgcagtatgcaaagactgtgactgt
gacccagacgggtcattggacggggggctgtgtgacgcccaagatagcccagctttgggt
ctcattgctggacagtgtcgatgcaaagactatgctgaaggcccaagatgtgatcgatgc
aagaccggattctttggcctgagtgcaaataactttcaaggctgccaaaggtgccagtgt
gacccaagaggtacaatctcgggcggtgcccagtgtgaccctatcagcggtgactgtttc
tgcaaacgctttgtgaccgggagaacatgcaaccagtgtctgccagaattttgggccctc
agtcatgaccttcatgggtgcagatcttgtgactgtgatgttggcggtgcctgggataat
cactgtgctatggagactggccagtgtcgatgccggagtcatatggttggcaggcaatgt
aaccaggtgaaatctggctattaccgaatacacttggatcattacacatacgaggccgaa
tctgctgtgcatcgacagggatgttcagtgttggagagggaacgtccaattggtcgtcag
gccacatggaccggtcctgggtttgccctggttccagagggtggaattctggagttccag
atcagcaacattccctattctatggagtatgatgtcatcatccgctacgaaccccagctt
tcagctatgtgggaacaagtaaaaatatccataattagaccaggtcctatcccaacaagc
agcccatgtggtaataccatcccggctgatgatcagatggtggcatctctaccccctggc
acaaggcatgtggtcctgcctcagccggtttgtctggaacgtggagtcagttacactatt
cgactggagtttagcagatacagttccagagaaagggtacctggagccagcatattggtt
gattcactggtgttggctcccagatactcggccatggaaatgttcatagccggggacccc
gcgtcaatacaacgcaaggacacttttgaacgttatcgctgccacagcaacagtggaaat
gtgataaagtcacctaccaccgaggtgtgctccggcctcatcacaagcatgtcggctgtc
attcacgaaggagccctgccctgcagctgtgacccacagggatctctgagctccgaatgt
gaccccaatggtgggcagtgccagtgtaaaactaacgtcattgggcagcgctgtgaccga
tgtgcaccaggaacttatggatttggaccaaccgggtgccgagtctgtgagtgcaataaa
gagggatccagccagaatttctgcgaccagcgcacgggtcagtgtccttgccggcaagga
gcatttggttccaggtgcgaccgctgccagcctggccactggggcttcccgaactgccgg
cagtgtcagtgcaacagtcattcggaagagtgcgaccagagaacaggggcgtgtctgaac
tgcagagaccacagcacaggagacagatgtgagagatgcattgcaggcttttttggaaac
ccagtactgggatcaggggatcactgccgcccctgcccctgcccagagggacccaccagt
gggcgacatttcgcagcatcctgtcaacaagacccccgttcaagacaagtcatctgtaac
tgcaaacagggatactcaggtgttcgctgtgatgaatgttctccagggttctttggaaat
ccattccagactgggggccgctgtcttctttgccagtgtaacaacaacatcgatatgaca
gatattggggcttgcgaccgtcgcagtgggcagtgcctcaaatgcaagtttaacaccgaa
gggaggttttgtgagcactgtcgaattggcttttatggtgatgcatcaaggcacaactgc
agaaagtgtgcatgtaactaccttgggacagaaccaagccagtgtccttcacgggaagac
tgtatgtgtgacagaacaagtggccagtgccattgcttgccaaatgtcatgggacagaac
tgcgaccgttgcagtcccaacttttggaacctggcaagcggcaagggctgtcagccgtgc
aactgtgaccccaaccattccttcagcctagcctgcaatgagtttactggaaaatgtcaa
tgccggcctggatttggtggtctgacctgtacagattgccaggaaaattactggggaaat
cccaatattcagtgcagggcttgtgattgtgatcgtcgtggtatcaaggcagcacagtgt
aacagagccactggtcattgctcctgccgtgctggagtgtcaggagtgcgttgtgaccag
tgtgcccggggattttccggccagtttcctgattgtcagccctgccatcagtgttttgga
gactgggaccgaatagttcaagatctggccactcgtactaagagcctggttcaaagaggc
aaggacatccagctgagtgggatagccggagtgtaccaaaagaatttccgtgacattgaa
aagaaacttgccaaggctcgggccattgtcattgctcgtaatgccactgtggagtcagtg
actcaactaatgaagatcatggatgacctgcggaataaaattaatgagtcaacggaggct
ctcacgcagttagaggtggagctgacgactgtgcaggatgagaactttgatgctaatcat
gatctggcggagctggaaaggaatgctcggagtttaaacatgactgccaaggagaggtcc
catcagttggatgttctaaagaactccaactttctgggtgcatatgacagcatccagcaa
tctcatgcaaaatctagacaggctgaaaaacaagccaataatgccaccactaatgttccc
agccctgttagccattcggccaggaccagggagaaggcccagcagctaatcacccacaag
cgtgacgatttcaacaggaagaatgcggctaatcgtcgggcacttaatgatttggcagct
aaaacagacacccttgacatgaagaagatcaatgagaaggtctgtggtgctccaggagat
gccccatgctctgagagcccttgtggtggagctggctgtcgtgatgatgaggggaacaga
cattgtggtgggttgaactgtaatggagctgtggctactgctgacaatgccttgggtcga
gcacgccatgctgaagaagaacttcagaaagcactgggagaagtagaagtgctttttcga
aaggtggctgaagcaaaggtaaaggcagacagagcaaaacagagggcacaggccaccctc
gacagagccaatgaaacaaaggcaagggtggaacagtccaataaggagctgcgggaactc
atccagcaaatcaaagactttctgaaccaggaaggtgcagacccagacagcattgagatg
gtggcaagccgtgtcctggatctcacaatcccagcaaccccaaagcagatacaacgtctt
gctgaagagatcaaggaccgagtgaaaactcttgcaaatgtggatgccattctggaccaa
accaccgctgacgtgcgcaaagcagaacaattgctgcacgaagccaaacgggccaagaac
cgagctgaaaatgtaaagaacacggcagagtctgttaaaaaggccctggatgatgctagg
agagctcagaatgctgcagaaggtgctatccgaactgccaataatgatatcaaagacacg
gagaggaaattaacagcaattcagacaacaacatctagtgcagagaattatctaaatgat
gctatggatcgagtgggaaatctggataaacaaattgatgctctgaaaatgaaaagggcc
aacaatagcctggctgccagccgagcagaagaatctgccactgtggcattggacaaagcc
aatgatgccaagaagatcttagaagggcaactcgcggacaaatacaaaactgttcagaat
gtcgttgatcggaaagccaagaacattaaagacgcaaagacaaaagcggaccaacttcaa
gatgaggcaaagaaactcttagataatgcacaggataaactaaagagattgcaagatttg
gaagttgaatatacgaagaatgagaaacttctacaggacaaagcaaaacagcttaatggc
ctagaagacaagatgaaggaaatcttacatggaattaaccaacagattcagatttataat
acgtgccagtaa

DBGET integrated database retrieval system