KEGG   Xenopus laevis (African clawed frog): 495002Help
Entry
495002            CDS       T01010                                 

Gene name
rptor, raptor
Definition
regulatory associated protein of MTOR, complex 1
Orthology
K07204  
regulatory associated protein of mTOR
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
mTOR signaling pathway
Insulin signaling pathway
Brite
KEGG Orthology (KO) [BR:xla00001]
 Environmental Information Processing
  Signal transduction
   04150 mTOR signaling pathway
    495002 (rptor)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    495002 (rptor)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
AA seq 1334 aa AA seqDB search
MELYTPALGLVGEDEESDLSDWNLPSAFMKKRHCEKIEGCKSLAQSWRMKDRMKTVSVAL
VLCLNVGVDPPDVVKTTPCARLECWIDPLAMGPQKALETIGANLQKQYENWQPRARYKQS
LDPTVDEVKKLCTSLRRNAKEERVLFHYNGHGVPRPTVNGEIWVFNKNYTQYIPLSIYDL
QTWMGSPSIFVYDCSNAGLIVKSFKQFALQREQELEVAAINPSHPLAQMPLPPSMKNCIQ
LAACDAAELLPMNPDLPADLFTSCLTTPIKIALRWFCMQKSVRLVPGVTLDLIEKIPGRL
NDRRTPLGELNWIFTAITDTIAWNVLPRDLFQKLFRQDLLVASLFRNFLLAERIMRSYNC
TPVSSPRLPPTYMHAMWQAWDLAVDICLSQLPTIIEEGTAFRHSPFFAEQLTAFQVWLTM
GVENRNPPEQLPIVLQVLLSQVHRLRALDLLGRFLDLGPWAVSLALSVGIFPYVLKLLQS
SARELRPLLVFIWAKILAVDSSCQADLVKDYGHKYFLSVLADPYMPAEHRTMTSFILAVI
VNNYNTGQEACLQGNLIAICLEQLNDPHPLLRQWVAICLGRIWQNYDAARWCGVRDSAHE
KLYSLLSDPMPEVRSAAVFALGTFVGNSAERTDHSTTIDHNVAMMLAQLINDGSPIVRKE
LVVALSHLVVQYESNFCTVALQFMEEEKNYPLPSPASTEGGSLTPVRDSPGTPRLRSVSS
YGNIRAVTTPRNLNKSLQNLSLSEETGSAITFSPGNLSTSSSASSTLGSPDNEEYILSFE
TIDKMRRVSSYSSLNSLIGVSFNSVYTQIWRVLLHLAADPYPEVSDLAMKVLNSIAHKAT
VNARPQRILDASSLTQSAPASPTNKGMHIHQVGGSPPTPSASSSSLTNDVTKPPVNRDIP
SNRPANVGGNIGVQYTPHSHQFPRTRKMFDKGPDQAADDGDEAIVHKNFAVGSFQTGFCD
WSAKYFAQPVMKMPEEHDVESQIRKEREWRFLRNARVRIQAQRIIQKGISRLDDQIFINR
NPGVPSVVKFHPFTSSIAVADKDSICFWDWEKGEKLDYFHNGNPRYTRITAVEYLNGQDC
SLLLTATDDGAIRIWKNFADLEKNPEMVTAWQGLSDMLPTTRGAGMVVDWEQETGLLITS
GDVRVIRLWDTDREMKVQDIPTGADSCVTSLSCDSNRSLIVAGLGDGSVRVFDRRMALND
CRVMTYREHSAWVIKTYLQKQSDGNIVSVSVNGDIRYFDLRMPECLNTLQIVKGLTALDI
HPQANLFACGSMNQFIAIYNANGELISNIKYYDGFMGQRIGAISCLAFHPHWPHLAVGSN
DYYMSIYSVEKRVR
NT seq 4005 nt NT seq  +upstreamnt  +downstreamnt
atggagctgtacacaccggccctgggactggttggggaagatgaagaaagcgatttgagc
gactggaacttgccgtctgctttcatgaagaagcggcattgtgagaagatcgaaggctgc
aagtccctggcacagagttggaggatgaaggaccggatgaagaccgtgagtgtggctctg
gtgttgtgcttaaatgtaggagtggaccccccagatgtagtgaagaccacgccatgtgct
cgcttggagtgctggatagatccactggctatgggtccacagaaagccctggaaaccatt
ggcgcaaacttacaaaagcagtatgaaaattggcaaccacgggctaggtacaaacagagt
ctggatccaactgtggatgaggtgaaaaaactctgcacttctctgagaaggaatgcaaag
gaggaaagagtgctgttccattataatgggcatggtgttccccgacctacagtcaatgga
gaaatctgggtgttcaataagaattacacacagtatattcccctttctatatatgacctg
cagacctggatgggaagtccgtctatctttgtgtatgactgctcaaacgcaggcctcatt
gtcaagtccttcaagcaatttgcactacagagggagcaggagcttgaggttgctgctatt
aaccccagccatccattagcgcagatgcctttgccaccgtcaatgaagaattgcatccag
ttggcagcttgtgatgcagctgaacttctgcctatgaaccctgatcttcctgctgacctt
tttacttcttgcttgaccacaccaattaagattgccctgagatggttttgtatgcagaaa
agtgtgagattggtgcctggcgttactctggatcttatagagaaaatccctgggcgatta
aatgatagaagaacaccactgggagagctgaactggatttttacagcaattacagatacc
atagcatggaatgttctgcctagagacctatttcagaagctttttagacaagacctgttg
gttgccagcctcttccgaaactttctgctggcagagaggataatgagatcatacaattgc
accccagtgagcagtcctcgcttgccacccacctacatgcatgctatgtggcaggcttgg
gatcttgctgtcgatatatgtctttctcagttacccaccattattgaggagggaactgca
ttccggcacagccctttctttgctgagcaactgaccgcatttcaagtctggttgaccatg
ggtgtagagaacagaaacccgccagaacagttgcccattgtcctgcaggtgttgttgagc
caggttcatagacttcgagccttggacctcttgggaagattcttggacctgggtccctgg
gctgtcagtttggccctctctgttggtattttcccctatgtgctgaagctgctacaaagt
tctgctcgggaactcagaccactgcttgtcttcatttgggccaagatccttgctgttgat
agttcttgccaagcagacttagtgaaagattatggtcataaatatttcctttctgttctg
gcggatccatatatgccggccgagcaccgtacaatgacctccttcattttagcagtaatt
gtaaacaattataacactggacaggaagcctgcctccaggggaacctgattgctatctgc
ttggagcagctaaatgatccacaccctctcctacgccagtgggttgctatctgcctgggg
cgcatctggcagaattatgatgctgcgcgatggtgtggggtgcgagacagtgcccatgag
aagttgtacagcctcttgtctgaccccatgcctgaggtccgcagtgctgcagtttttgcc
cttggcaccttcgttgggaattcagctgagagaacagatcactcaacaacaatagatcac
aatgttgctatgatgttagcacagcttatcaatgatggaagtcctatagtgcgcaaggaa
cttgttgtggctctcagtcacctggttgtacagtatgagagcaacttctgtacagttgct
ctccagtttatggaggaagagaagaactaccccctaccctcaccagcttccacagaggga
ggcagtttgacgccagtacgagatagccctggaacaccccgcctgcgatctgtgagctcc
tatggcaatatccgggcagtgacaactccaagaaacctcaacaagtctctgcaaaatcta
agcctgagtgaagagactgggagtgccataacattttctcctggaaatctaagtacaagc
agcagtgcaagcagtactttgggaagcccagataatgaagagtacatattgtcctttgag
accattgataaaatgaggcgtgttagttcgtactcctctcttaattccctcataggtgtc
tcgttcaatagtgtttacactcagatttggagagtgcttctccaccttgcagctgaccca
taccctgaagtttcagaccttgcaatgaaagtgttaaacagcattgcacataaggctaca
gtgaatgctcgcccacagcggatccttgatgcttcttcactcactcagtctgctccggcc
agtcccaccaacaaagggatgcacattcaccaagtgggaggttcacctccgactcccagc
gcaagcagttccagtctcaccaatgatgtaacaaaaccacctgtcaatagggatattccc
tccaatcgacctgccaatgttgggggaaatataggggtgcagtacactcctcattcccat
cagtttccccgtaccaggaaaatgtttgacaaaggaccagatcaggctgcagatgatgga
gatgaagctattgtgcacaagaactttgctgtaggatcttttcagacaggcttttgtgat
tggagtgccaaatattttgcccagccagtcatgaagatgccagaggaacacgatgtggaa
agtcagatacgtaaagaacgtgagtggcgctttttacgaaatgcaagggtccgaatacag
gcccagcgtattatacagaaaggaatctcacgactagatgaccagatctttatcaaccgg
aatccaggagttccttctgttgtaaagttccatccttttacctcaagcattgcagtagca
gacaaggacagcatttgtttctgggactgggagaaaggggagaaactggactacttccat
aatggtaaccctcgttatacccgaataacagcagtcgaatacctaaatggccaagattgc
tctttgctgctcactgctacagatgatggagccatccgcatatggaagaactttgctgac
ttagagaaaaatccagagatggttacagcttggcagggattgtctgatatgctgcccacc
acacgaggagctggtatggtggttgattgggagcaagaaacaggacttctcatcacatct
ggagatgtaagagtcatccggctatgggatacagaccgagagatgaaagtgcaggacata
cccactggagcagacagttgtgtgaccagcctgtcatgtgactctaatcgttcccttatt
gtggctggactcggagatggttctgtgcgtgtgtttgaccgcaggatggcgctgaatgac
tgccgtgtgatgacataccgagaacactcagcctgggtcataaagacttatctccaaaag
cagtcagatgggaatattgtgagcgtcagtgtgaatggagatatccgttacttcgacctt
cgtatgcctgaatgtttaaacaccctgcagattgtaaagggtcttactgcattggatatc
catccacaggcgaacttatttgcatgtggctcaatgaaccagttcattgctatttacaat
gcaaatggagagctgatcagcaacataaaatactacgatggatttatgggacagagaata
ggagccattagctgcctggccttccatcctcactggccccacctggccgttggcagtaac
gactattacatgtctatttactcagtggaaaagcgagtgagatag

DBGET integrated database retrieval system