KEGG   Xenopus laevis (African clawed frog): 495110Help
Entry
495110            CDS       T01010                                 

Gene name
usp44-b
Definition
ubiquitin specific peptidase 44 (EC:3.4.19.12)
Orthology
K11834  
ubiquitin carboxyl-terminal hydrolase 44/49 [EC:3.1.2.15]
Organism
xla  Xenopus laevis (African clawed frog)
Brite
Enzymes [BR:xla01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     495110 (usp44-b)
Peptidases [BR:xla01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   495110 (usp44-b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
AA seq 690 aa AA seqDB search
MDKCKHVGRLRLAQDHSILNPQKWHCVDCNTTESVWACLSCSHVACGRYIEEHALRHFQD
SKHPLALEVNELYVFCYLCDDYVLNDNTTGDLKLLRSTLSAIKSQNYDCTTRSGRTLRSM
VSADDSFISHEGAQAFLQNEDRAFTALWHRRHALLGKVFRSWFALTPKGKQRLEEERLRE
EAEHKREEARKRRQQLKHKLKEEMESTPPRKSSRLQQQIQPSPKIESSSVQKMNQKNAPS
TKQNPPAPTSDKARLKKIGNSPIKRKPTVTPGVTGLRNLGNTCYMNSILQILSHLHVFRE
CFLQLDLNQTQELLAADGSGKTRLSSKYPPGAELPRVTQKHTKGQRSLARRPSFSLGLSG
GASNSRNMELIQPKEPSSKHISLCHELHTLFQVMWSGKWALVSPFAMLHSVWRLIPAFHG
YAQQDAQEFLCELLDKVQQELETTGTRYPALIPTSQRKLIRQVLNVVNNIFHGQLLSQVT
CLVCDHKSNTIEPFWDLSLEFPERYHFSGKATASQRPCLLTEMLAKFTETEALEGKIYAC
DQCNKAQKQLMVCRLPQVLRLHLKRFRWSGRNHREKIGVHVRFDQMLNMEPYCCRESTAA
LRADCFIYDLSSVVMHHGKGFGSGHYTAFCYNPEGGFWVHCNDSKLHSCAVEEVCKAQAY
ILFYTQRVTQENGHLSERLPLHDSPQSPPP
NT seq 2073 nt NT seq  +upstreamnt  +downstreamnt
atggataaatgtaaacacgttggccgattgcgtcttgcccaagatcattcgattttgaac
cctcagaagtggcactgtgtggattgcaacactacagaatcagtgtgggcttgcctaagc
tgttcacatgttgcatgtggtcgatacattgaagagcatgcactgcgtcactttcaggac
agtaagcatcccttggctttggaggttaatgaactttatgtgttttgttacctctgtgat
gattatgttctcaatgacaacaccactggtgaccttaaacttttacgaagcacattaagt
gcgatcaaaagtcagaattacgactgtacaacacgtagtggtcggactttgcggtctatg
gtaagtgcagatgattcattcatttcacatgaaggcgcacaagcctttcttcagaatgaa
gaccgagcattcactgcattgtggcatcggaggcatgctctcttagggaaggtttttaga
tcatggtttgctttgactccaaaaggcaagcagaggttagaagaggaacgcttgagggaa
gaggccgagcacaagagggaggaagcaagaaaaaggcggcagcaattgaagcacaaatta
aaagaagaaatggaaagcactccccccagaaagagttcacgtttgcaacagcaaatacag
ccttcacccaaaattgaatcgtcctctgtgcaaaaaatgaaccaaaaaaacgctccttcc
acaaaacaaaatccaccagcacctacctctgataaagcacgcttaaagaaaattggtaat
tctccaataaaaagaaagcccactgtgacccctggagtaacaggactgaggaatctgggg
aacacttgctatatgaactcaatacttcaaatactgagtcatttgcatgtttttcgggag
tgttttttacaacttgatctcaatcaaactcaggagttgttggcagctgatggcagtgga
aaaacaaggctgtccagcaaatacccacctggtgctgagctaccaagagtaacacaaaag
cacactaaaggtcaaagatcactggcaaggcggccaagcttctccttgggacttagtggt
ggggcctcaaatagtagaaacatggaacttattcagcctaaggagccaagttcgaagcac
atatccctatgccatgaattgcataccctcttccaagtcatgtggtcagggaaatgggca
ctggtttctccttttgcaatgctgcattcagtgtggaggcttataccagctttccatggg
tatgcacagcaagatgctcaggaatttctctgtgaactattagataaagtgcaacaagaa
ttggagacaactggcaccagatacccagccctaattcctacatctcaaagaaaactcatc
agacaggtcctgaatgtcgtcaacaacatttttcatgggcaactgcttagtcaggttaca
tgtctcgtctgtgatcacaagtcaaataccatcgagccattttgggacttgtctcttgaa
tttcccgagaggtaccacttcagtggcaaagcgacggcttcccaacggccttgtttgttg
acagaaatgctggctaaattcacagagactgaagccttagaagggaagatctacgcatgc
gatcagtgcaacaaagcacagaagcagctgatggtgtgtcgcttacctcaggtcctgaga
ctccacctcaagagattcaggtggtctggccgtaaccatagagaaaaaatcggagtgcat
gttcgattcgaccagatgctgaacatggagccttattgttgtagagagtccactgcagcc
ctgagagctgactgctttatttatgatctgtcttctgtggtgatgcatcatgggaaaggc
tttggttctggccattacactgccttttgttacaatccggaaggaggcttctgggtacac
tgcaatgactccaagctacattcatgtgccgtggaagaggtgtgcaaggcacaagcatac
atcttattttatacccagcgagttactcaggagaatggacatttgtcagaaagacttcct
ctccatgacagtccgcaatccccacccccttga

DBGET integrated database retrieval system