KEGG   Xenopus laevis (African clawed frog): 495169Help
Entry
495169            CDS       T01010                                 

Gene name
pdia4
Definition
protein disulfide isomerase family A, member 4 (EC:5.3.4.1)
Orthology
K09582  
protein disulfide-isomerase A4 [EC:5.3.4.1]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
Protein processing in endoplasmic reticulum
Class
Genetic Information Processing; Folding, sorting and degradation; Protein processing in endoplasmic reticulum [PATH:xla04141]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
AA seq 637 aa AA seqDB search
MEKKAYLLLLLLGLAHVAIVTCDQEEKDPKEHHNNVDANEDEAEVEDETQVKDENGVLVL
TDANFDIFVTDKDIVLLEFYAPWCGHCKQFAPEYEKIASALNQNDPPVPVAKIDATVATN
IAGRYDISGYPTIKILKKGQPIDYDGARTQEALVAKVKEIAQPDWKPPPEATIVLTTDNF
DEVVNNADIILVEFYAPWCGHCKKLAPEYEKAAQELSKRSPPIPLAKVDATVESSLGSKY
GVTGFPTLKIFRKGKAFDYNGPREKYGIVDYMTEQAGPPSKQIQAVKQVHEFFRDGDDVG
VLGVFSGEEDHAYQLYQDAANSLREDYKFYHTFSSEIFNSLKVSPGQLVVMQPEKFQSKY
EAKKYILNFKDSTTADDIKQHITEHSLPLVGHRKSSNEAKRYSKRPLVVVYYSVDFSFDY
RTATQYWRSKVLEVAKDFSEYTFAIANEDDYTSELKDLGLSDSGEEVNVAIFDASGKKYA
KEPEELDSDGLRDFVTAFKKGKLKPIIKSQPVPKNNKGPVKVVVGKTFDQIVMDPESDVL
IEFYAPWCGHCKSLEPIYNDLGKKYRSTQGLIIAKMDATANDISSDKYKVEGFPTIYFAP
QNNKQNPIKFSGGNRDLEGFSKFIEEHAVKLKRKDEL
NT seq 1914 nt NT seq  +upstreamnt  +downstreamnt
atggagaagaaggcttatcttttgttgcttctattggggttagcgcatgtcgctatcgtt
acctgtgatcaggaggagaaagacccaaaggaacaccacaacaatgtggatgccaatgag
gatgaagcagaagtggaggatgaaacacaagtgaaggatgaaaatggcgttttggtgctg
actgatgcaaactttgacatttttgttactgacaaagacatagtacttctagaattttat
gcaccctggtgtggacactgcaagcagtttgctccagaatatgaaaagattgccagtgct
ctgaaccaaaatgaccctccggttccagttgcaaaaattgatgccacggtagcaactaat
attgccggtagatatgacattagtgggtatcctacaatcaagatcttaaagaaaggccaa
cccattgattacgatggtgcaagaacacaggaagcacttgtggcaaaagtaaaagaaatt
gcccaacctgattggaagccacctcctgaagcaaccattgtattgaccacagacaacttt
gatgaagtagttaacaatgcagacatcatactggttgaattttatgcaccttggtgtgga
cattgtaaaaagcttgcaccagaatatgagaaggcagcacaagagcttagtaaacgttcc
ccacccataccattggcaaaggttgatgcaactgttgaaagtagcttggggagtaaatat
ggagtcactggctttcccacgctgaagattttccgcaaaggcaaggcttttgattacaat
ggaccaagagaaaaatacggtattgttgactatatgactgagcaggctggcccaccgtca
aaacagatccaagctgtcaagcaggtgcatgaattctttagagatggagatgatgttggt
gttcttggtgtttttagtggcgaggaagaccatgcttaccagctttaccaagatgcagca
aacagtttaagagaggattataaattttaccacacattcagctcagaaatttttaactct
ctaaaagtttcacctggtcagctagtagtcatgcagcctgaaaaatttcaatcaaaatat
gaggcaaagaagtacattcttaacttcaaagactctaccactgctgatgatattaagcaa
cacattacagaacattccttacctttggttggacataggaagagctcgaatgaagccaaa
agatattcaaagcgtccccttgttgttgtctactacagtgtggatttcagttttgattat
cggactgctacccagtattggcgaagtaaagtcttggaggttgcaaaagatttttcagag
tatacatttgcaattgccaatgaagatgattatacatctgaactgaaagatttgggttta
agtgacagtggagaagaagttaatgttgccatttttgatgccagtggaaagaagtatgcc
aaagaacccgaagaattggattctgatggacttagagactttgtaacagcatttaagaaa
ggaaagctgaagcctataataaagtcacaacctgtgccaaagaataacaaaggccctgtt
aaagttgtagttggaaaaacctttgaccagattgtaatggatccagagtctgatgttctc
atagagttctatgctccttggtgtgggcactgcaagtcattggagcctatttacaatgat
ctgggtaaaaaatacagatcaacacagggccttattattgcaaaaatggatgccactgcc
aatgacatttccagtgacaagtacaaagtggaaggattccctacaatatattttgcaccc
cagaataataaacaaaacccaattaagttttcaggaggtaacagagatttggaaggcttt
agcaagtttattgaagaacatgcagttaaactaaagagaaaggatgagctctga

DBGET integrated database retrieval system