KEGG   Xenopus laevis (African clawed frog): 495215Help
Entry
495215            CDS       T01010                                 

Gene name
gbe1, gbe
Definition
glucan (1,4-alpha-), branching enzyme 1 (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:xla00500]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
AA seq 686 aa AA seqDB search
MATELGTVEVPELDVLLGQDPYLKPYEKDFHRRYRLFDRLLKSIEGNEGGLEKFSRSYQS
FGVHVLENGGICCKEWAPGAEAMFLTGDFNGWNPFSHPYKKLDYGKWELHIPPREDKSVI
IPHGSKLKVVMTSKSGETLYRISPWAKYVIREDNKAVYDWVHWEPPQPYKRKHASPKKLK
SVRIYEAHVGIASSEGRIASYKNFTDNVLPKIKDLGYNCIQMMAIMEHAYYASFGYQITS
FFAASSRYGTPDELKELIDVAHSMGIQVLLDVVHSHASNNTEDGLNKFDGTDSCFFHDGA
RGIHALWDSRLFDYSNWEVLRFLLSNLRWWIEEYGFDGFRFDGVTSMLYHHHGIGCGFSG
GYNEYFGLHVDEDSLLYLLLANHMIHTLYPHCITVAEEVSGMPAICCPISQGGVGFDYRL
AMAVPDKWIQILKELKDEDWDMGNIVHTLTNRRYNEKCIAYAESHDQALVGDKSLAFWLM
DAEMYTNMSVFSPLTPVIDRGMQLHKMLRLITHALGGEGYLNFIGNEFGHPEWLDFPRKG
NGESYHYARRQFHLIDDQQLRYRFLYAFDRDMNKLEEKFGWLAAPQAYISAKHESDKIIA
FERANLIFIFNFHPYKSYTGYRVAVNKPGKYMIALDTDSSEYGGHQRINHKTEFFAEDAP
YNSCSHSILVYIPCRVAIVLCNIDNS
NT seq 2061 nt NT seq  +upstreamnt  +downstreamnt
atggctactgaactaggtacggtggaggtgcccgagctggacgtgctgttggggcaggac
ccgtacctcaagccgtatgagaaagacttccacagaaggtacaggttatttgaccgactc
ttgaaaagcattgaaggaaatgaaggaggtttggaaaagttctccaggagttaccaatca
tttggcgttcatgtacttgaaaacggtgggatttgttgtaaggaatgggctcctggagct
gaagctatgttccttactggagattttaatggttggaaccctttttcacatccatataaa
aaactggattatgggaaatgggaactacatattccaccccgagaagataaatctgttata
attcctcatggatcaaagctgaaggttgtaatgactagcaaatctggagagactctgtac
cgaatatctccttgggcaaaatatgtgattcgggaagataataaagcggtgtatgactgg
gtacattgggaaccaccacagccttataaacgcaagcatgctagccccaagaagctaaag
agtgtgcgtatatatgaagctcatgttggaattgcatcttcagaaggaagaattgcttca
tataaaaactttacagacaacgttctgcccaaaataaaagatcttggttataattgcata
caaatgatggctattatggagcatgcctattatgcaagctttggttatcaaatcaccagc
ttctttgcagcttcaagtcgctatggcacaccagatgagctgaaagaactgattgatgtt
gctcactcaatgggaatccaagttcttcttgatgttgtacatagccatgcatcaaacaat
actgaagatggtctcaataaatttgatggcacagactcgtgcttttttcatgatggggct
cgaggaatccatgctctttgggatagcagactttttgactactcgaattgggaagtttta
agattccttctatcaaacttgcggtggtggattgaggaatatggatttgatgggtttcga
tttgatggggttacatccatgttgtatcaccaccacggtataggttgtggattttctgga
ggttataatgaatattttggacttcacgtggatgaagattctctgttgtaccttctgttg
gcaaaccacatgatacatacactttatcctcattgcattacagtagccgaggaagtgtca
ggaatgccagcgatttgctgccctatatctcaaggtggtgttggatttgattaccgacta
gcaatggctgtgcctgacaaatggattcagatcttaaaagagctaaaagatgaagattgg
gacatgggtaatatagtgcacacattaaccaatagacgatataatgagaaatgtatcgcc
tatgcagaaagccatgatcaggcacttgttggagataagagtttagcattttggttaatg
gatgcagaaatgtacacaaacatgagtgtattctcgccattgactccagttattgatcgg
ggaatgcaactccataaaatgctgcgtctgattactcatgctcttggaggtgaaggctat
ctcaacttcataggtaatgagtttggacacccggaatggttggatttcccaaggaaagga
aatggggaaagctaccattatgccagaaggcaatttcatttaattgatgatcaacaacta
cgctatagattcctttatgcttttgatagagatatgaataaactagaagaaaagtttgga
tggcttgctgcaccacaggcctatatcagtgcaaagcatgaaagtgataagatcattgca
tttgaaagggcaaatcttattttcatctttaatttccatccatacaaaagctatactgga
tacagagttgcagtgaacaaacctgggaagtatatgatcgctctggatacagattcttct
gaatatggtgggcatcaaagaataaaccataaaactgaatttttcgcagaagacgcacct
tacaacagttgttcacattcaattttggtctacattccatgcagggttgcaattgttctt
tgcaatattgacaactcctaa

DBGET integrated database retrieval system