KEGG   Xenopus laevis (African clawed frog): 495232Help
Entry
495232            CDS       T01010                                 

Gene name
prf1
Definition
perforin 1 (pore forming protein)
Orthology
K07818  
perforin 1
Organism
xla  Xenopus laevis (African clawed frog)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
AA seq 532 aa AA seqDB search
MLHFFMIICFIPLICSSAPLLHTVTCKQGTKTQCLKASFVPGHNLPARGIDIVTMKSAGN
ILFNTQQYMKNNTCKLCQDSQDKDKWWKLPRALEQWNMQSSCRRTMVSKVLQSPVLVAKE
VASRVQNDWTNDLNLTCTELQGNVAMAGAQSKMVQFAFEKLHLDKYTFLSHKFECEYYSF
QMSRHWNLSPHFLKALVQLPNYYNSRSNVQYQQLIASYGTHYITDATMGGQLQEVTALRT
CEVALSDSTMQLVKDCREAEIMAAVVGPNNTMLSQICVPSTRKYIYVGNFHQGFNERFRE
VAGGNAMFDLHNHLSGENKWLKSTEKDPALLNYSLMPIHTLINSRSPKRESLRIALSEYI
KKRSLKIECPCSGNTYPSQREDCSCSCSPSKYTNSDCCPTRKGLAKLIIEIRSATGLNGD
YFSSTDSYVNFYFNGYEKETETIFDNDDPMWNETLDFGMVELGPLKKYTIEVWDEDITTD
NDLLLTCKGILKAGNNKMSCQYSDMQLVYTLYTTCAPYLGGEYCDEYIPSSP
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atgctccatttcttcatgatcatctgtttcatccctttgatatgttcttccgctcccctg
cttcacaccgttacttgtaagcaaggcacgaagacacaatgtctcaaggcctcctttgta
ccagggcacaacctccctgcaagaggaatagatatagtgaccatgaagagtgctgggaac
attctgtttaacacccagcagtacatgaaaaataacacttgtaaattgtgccaagattct
caagataaagacaaatggtggaaattacctagagccctggagcaatggaatatgcaaagt
tcctgcagaaggaccatggtgagcaaagtcttacaatctccagtcttagtggccaaggaa
gtggcatcacgtgtgcagaatgattggacaaatgatctgaatttgacatgcacagaactg
caaggaaacgtagccatggctggtgcccaatccaaaatggtgcagtttgcttttgagaaa
ttgcatttggacaaatatactttcctctcccacaagtttgaatgtgaatattacagtttt
cagatgtctaggcattggaacctaagtccacattttttgaaagctcttgtccagctccct
aactactataactcccgaagcaacgtacagtatcaacaactgatagcctcgtatggcaca
cactatatcactgatgcaacaatgggggggcagttgcaggaagtgactgcattaagaacc
tgcgaagtggctttgagtgatagcacaatgcagctggtgaaagactgccgggaagcagag
atcatggctgctgtggttggtccaaacaacacaatgctaagtcagatatgtgtgccttca
accagaaaatatatttacgtaggaaacttccatcagggatttaatgaaaggtttcgggag
gtggcaggaggaaatgccatgtttgaccttcataatcatttgtctggggaaaataagtgg
ttgaagagtactgagaaggatcctgctctactgaattactcattgatgcccatccacacc
ttaattaattccagaagtcctaagagagaaagcctaagaattgctctcagtgaatacatc
aaaaagaggtccttgaagatagaatgtccatgctcaggaaatacctatccaagccagagg
gaggattgctcttgttcttgttccccatccaaatataccaactcagactgctgcccaaca
agaaaaggattagccaagttaatcattgaaattagatctgccacgggtctgaatggagac
tatttctcatcaacagacagttatgtaaacttctatttcaatggatatgaaaaagagact
gaaactatatttgacaatgatgatcctatgtggaatgaaacacttgattttgggatggta
gagcttggccctctgaaaaagtacactatagaggtgtgggatgaagacattacaacagat
aatgacctactcttaacatgtaagggaattctaaaagcagggaataataaaatgtcatgc
caatacagtgatatgcaattagtgtacaccctttacacaacctgtgccccttatcttgga
ggtgaatattgtgatgaatacattcccagttcaccatga

  All links  
No link information was found.   
DBGET integrated database retrieval system