KEGG   Xenopus laevis (African clawed frog): 495290Help
Entry
495290            CDS       T01010                                 

Gene name
prkaa1, ampk, ampka1
Definition
protein kinase, AMP-activated, alpha 1 catalytic subunit
Orthology
K07198  
5'-AMP-activated protein kinase, catalytic alpha subunit [EC:2.7.11.11]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
FoxO signaling pathway
Regulation of autophagy
mTOR signaling pathway
Insulin signaling pathway
Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:xla00001]
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    495290 (prkaa1)
   04150 mTOR signaling pathway
    495290 (prkaa1)
 Cellular Processes
  Transport and catabolism
   04140 Regulation of autophagy
    495290 (prkaa1)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    495290 (prkaa1)
   04920 Adipocytokine signaling pathway
    495290 (prkaa1)
Enzymes [BR:xla01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     495290 (prkaa1)
Protein kinases [BR:xla01001]
 Serine/threonine protein kinases: CAMK group
  CAMKL family
   495290 (prkaa1)
Mitochondrial biogenesis [BR:xla03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    495290 (prkaa1)
  Mitophagy factors
   Other mitophagy factors
    495290 (prkaa1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
AA seq 560 aa AA seqDB search
MRRLSSLMKMAADKQKHHDGRVKIGHYILGDTLGVGTFGKVKVGKHELTGHKVAVKILNR
QKIRSLDVVGKIRREIQNLKLFRHPHIIKLYQVISTPTDIFMVMEYVSGGELFDYICKHG
KLDEKESRRLFQQILSGVDYCHRHMVVHRDLKPENVLLDAHMNAKIADFGLSNMMADGEF
LRTSCGSPNYAAPEVISGRLYAGPEVDIWSCGVILYALLCGTLPFDDDHVPTLFKKICDG
IFYTPQYLNPPVISLLKHMLLVDPMKRATIKDIREHEWFKQDLPKYLFPEDPSYSTNMID
DEALKEVCDKCECTEEEVLSCLYSHNHQDPLAVAYHLIIDNRRIMNEAKDFYLATSPPDS
FMEDPPIARPHPERVPFLVAESPRQRHTLDELNPQKSKHQVGVRRAKWHLGIRSQSRPND
IMAEVCRAMKQLVYEWKVVNPYYLRVRRKNPVTSMYTKMSLQLYQVDSRTYLLDFRSIDD
DVTEAKSESATPRRSGSISNNRPPKNESDPEFQAKSSDGSGPSSLTSSVDSSNTDLVPRP
GSHTIEFFEMCANLIKILAR
NT seq 1683 nt NT seq  +upstreamnt  +downstreamnt
atgcgcaggctcagttcgctcatgaagatggcggcggataaacagaagcatcatgacggg
agggtgaagatcggtcactacattctgggagacacgcttggggtgggcacgtttggcaaa
gtaaaagttggcaaacatgaattgactggacacaaggttgcagtgaagattttaaaccgg
cagaagatccgcagccttgatgtggttgggaaaattcgccgcgagatccagaatctgaag
ctcttcaggcatcctcatatcattaagctgtaccaggtcatcagcacgccaactgatatc
tttatggttatggagtatgtttctggcggggaactctttgattatatttgcaagcatggc
aagttggatgaaaaggaatcccggcgtttgttccagcaaattctttctggcgttgactat
tgccatagacatatggttgtacacagagacttgaagcctgagaatgttctcctcgatgcc
cacatgaatgcgaagattgcggattttggcctctctaacatgatggctgatggggaattc
ctacgaaccagctgtggctcccctaattatgctgccccagaggttatttcaggaagactt
tatgctggtccagaggtggacatatggagctgtggggtcatcctatacgctttactctgt
ggaactcttccttttgatgacgatcacgtgccaacactttttaagaagatatgtgacggc
atcttctacacaccccagtacctgaatcctcccgtgattagccttctaaagcacatgctg
ttggtggatcccatgaaaagggcaaccattaaagatattagggaacacgaatggttcaag
caagatcttcctaaatatctgtttccggaggacccatcctacagtacaaatatgatcgac
gatgaagccttaaaagaagtgtgtgataagtgtgagtgcacggaagaagaagtgctgagc
tgcttgtacagtcacaaccatcaggatccattagcagtcgcctaccatctgatcatagat
aatcgcaggataatgaatgaggccaaagacttctatttggctaccagtcctccggattcc
ttcatggaagatcctcctatagctcggcctcacccagagagagtgccctttttagtggcc
gagtcacctcggcaacggcacactctcgatgagttaaacccgcaaaagtccaaacaccag
gttggggtaagaagagccaaatggcatcttggtatacgaagtcagagccgaccaaatgat
atcatggctgaggtttgccgagcaatgaaacagttggtctatgagtggaaggttgtaaat
ccctactacctgcgcgtgagaaggaagaatccggttactagcatgtacaccaagatgagc
ctccagctgtaccaagtggatagcagaacttacctgctggatttccgtagcattgacgat
gacgttactgaagccaagtcagaaagcgccacccctaggagatccggctccattagcaat
aaccgacctccgaaaaacgaatctgatcctgaatttcaagcaaagtcttcagacggctca
gggccgtcctctttaacctcatccgtggactcttccaataccgacttagtccccaggcct
ggaagccataccatagaattttttgaaatgtgtgcaaatctaataaaaatccttgcacga
tag

DBGET integrated database retrieval system