KEGG   Xenopus laevis (African clawed frog): 495339Help
Entry
495339            CDS       T01010                                 

Gene name
gpx8-b
Definition
probable glutathione peroxidase 8-B (EC:1.11.1.9)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:xla00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:xla00480]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 209 aa AA seqDB search
MEPLSPYPLKCSSPKAKVFLVFFSMVLCTGILCVLQLKFLRAKGGDFYSYEVTDAKGRTV
ALSKYRGKASLVVNVASGCPHTEANYRSLQELHREFGPSHFTVLAFPCNQFGESEPGTNK
EIEAMAKRNYGVTFPVFSKIKILGSEAEPAYRFLVDSTKKEPRWNFWKYLVDPQGQVVKY
WRPDETAESIRPEVASLVRQIIMKKKEDL
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
atggagccgctctctccctaccccttaaagtgctcttcccccaaagccaaagtcttcctc
gtcttcttctccatggttctgtgcacggggatcctgtgtgtcctgcagctcaagttcctc
agggccaaagggggagacttctactcgtacgaggtgactgatgccaaggggaggactgtg
gccctatccaagtacagaggcaaagcatctctggttgtaaacgtggccagtggctgcccg
cacaccgaggcaaactacagatctctgcaggagttgcacagggagtttggcccttcccat
ttcaccgttttagctttcccttgcaatcagtttggcgagtcggagcccggcactaacaag
gagatcgaggctatggccaaaaggaattatggagtgactttccctgtgttcagcaaaata
aagatcctgggttcggaagcagagccggcctataggttccttgttgattcaactaaaaaa
gaaccacgttggaatttctggaaatatctggttgacccccaaggccaagttgtgaaatac
tggaggcctgatgagactgctgagagcatccggcctgaagtggcctctttagtcagacaa
ataatcatgaagaagaaagaagacctgtga

DBGET integrated database retrieval system