KEGG   Xenopus laevis (African clawed frog): 495339Help
Entry
495339            CDS       T01010                                 

Gene name
gpx8-b
Definition
probable glutathione peroxidase 8-B (EC:1.11.1.9)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:xla00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    495339 (gpx8-b)
  Metabolism of other amino acids
   00480 Glutathione metabolism
    495339 (gpx8-b)
Enzymes [BR:xla01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     495339 (gpx8-b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 209 aa AA seqDB search
MEPLSPYPLKCSSPKAKVFLVFFSMVLCTGILCVLQLKFLRAKGGDFYSYEVTDAKGRTV
ALSKYRGKASLVVNVASGCPHTEANYRSLQELHREFGPSHFTVLAFPCNQFGESEPGTNK
EIEAMAKRNYGVTFPVFSKIKILGSEAEPAYRFLVDSTKKEPRWNFWKYLVDPQGQVVKY
WRPDETAESIRPEVASLVRQIIMKKKEDL
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
atggagccgctctctccctaccccttaaagtgctcttcccccaaagccaaagtcttcctc
gtcttcttctccatggttctgtgcacggggatcctgtgtgtcctgcagctcaagttcctc
agggccaaagggggagacttctactcgtacgaggtgactgatgccaaggggaggactgtg
gccctatccaagtacagaggcaaagcatctctggttgtaaacgtggccagtggctgcccg
cacaccgaggcaaactacagatctctgcaggagttgcacagggagtttggcccttcccat
ttcaccgttttagctttcccttgcaatcagtttggcgagtcggagcccggcactaacaag
gagatcgaggctatggccaaaaggaattatggagtgactttccctgtgttcagcaaaata
aagatcctgggttcggaagcagagccggcctataggttccttgttgattcaactaaaaaa
gaaccacgttggaatttctggaaatatctggttgacccccaaggccaagttgtgaaatac
tggaggcctgatgagactgctgagagcatccggcctgaagtggcctctttagtcagacaa
ataatcatgaagaagaaagaagacctgtga

DBGET integrated database retrieval system