KEGG   Xenopus laevis (African clawed frog): 495363Help
Entry
495363            CDS       T01010                                 

Gene name
cyp3a5
Definition
cytochrome P450, family 3, subfamily A, polypeptide 5 (EC:1.14.14.1)
Orthology
K07424  
cytochrome P450, family 3, subfamily A [EC:1.14.14.1]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
Steroid hormone biosynthesis
Linoleic acid metabolism
Retinol metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xla00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    495363 (cyp3a5)
   00591 Linoleic acid metabolism
    495363 (cyp3a5)
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    495363 (cyp3a5)
Enzymes [BR:xla01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     495363 (cyp3a5)
Cytochrome P450 [BR:xla00199]
 Cytochrome P450, animal type
  CYP3 family
   495363 (cyp3a5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
AA seq 510 aa AA seqDB search
MTFLPDFSMETWTLLVLLLTLLAYYAIWPYRLFKRHGIPGPTPIPFIGTFLGNRNGIMEF
DMECFKKYGNVWGFYDGPKPLLAIVDPVIIKNIMIKECYTNFTNRRDFGLSGPLKSSVLI
SKDEQWKRIRTVLSPTFTSGKLKQMFPVMKHYGELLVKNIQKKIDNKEPLNMKYIFGSYS
MDTILSTSFSVNVDSMNNPNDPFVTNARNLFTFSFFNPLFLLTILCPFLVPLLDKMNFCF
LSLKILNFFKDAVASIKKKRQKDIHEDRVDFLQLMVDAQNNEGDSVPEGEKQRYKELSDD
EILAQSLIFIMAGYETTSTTLMFLAYNIAMHPDVQSRLEEEIDTLLPNKAPPTYEALMKM
EYMDMVINETMRLFPSAIRIDRVCKKTMEINGVTIPAGVVIVVPLFVLHLNPEVWPEPEK
FQPERFSKENQKNQDPYSFLPFGTGPRNCIGMRFALVNMKLALTLLLQNFRFEKCEDTPD
PLNICTKGYLKPTKPIILKLVPKTAQTMKE
NT seq 1533 nt NT seq  +upstreamnt  +downstreamnt
atgactttcctcccagacttctctatggaaacatggaccctgcttgtcctgctgctgaca
ctccttgcttattatgcaatctggccatatagattattcaaaagacatgggattcctggc
cctacccccattccatttattggaactttccttggaaacagaaatggcattatggaattt
gacatggagtgcttcaagaaatatggaaatgtttgggggttttatgatgggcctaagcct
ttacttgctatagtggatcctgtgataattaaaaacatcatgatcaaggaatgctacacc
aatttcaccaatagaagggattttggtttaagcgggcccttgaagtcttctgtccttatt
tccaaagatgagcagtggaaaaggatccgcacagtgctttcacctacttttaccagtgga
aaattaaaacagatgttccctgtaatgaaacactatggagagcttttggtgaagaatatc
caaaagaaaatagataacaaggagcctctaaacatgaagtatatttttggaagttacagc
atggacacgatcctaagcacatcattcagcgtcaatgtggattccatgaataaccccaac
gatccatttgtcaccaacgccaggaatctcttcacattctctttcttcaatcccctgttt
ctgcttacaattttatgtcccttccttgttcctcttttggacaaaatgaacttttgtttt
ctctctttgaaaatcctaaactttttcaaagacgcagtcgcaagcatcaagaaaaaaagg
caaaaggatattcatgaggatagagtggatttccttcagcttatggttgatgcacaaaac
aatgaaggcgattcagtaccagaaggagaaaaacagagatataaagagttgtcagatgat
gagattctcgcacaatcacttatcttcataatggctggatatgaaactacaagcacaacc
ctcatgtttctggcatataacatagcaatgcatccggatgtacagagcagacttgaagaa
gagattgatactttattgcctaacaaggcaccaccaacctatgaagcacttatgaaaatg
gaatatatggatatggtgattaatgagaccatgagattgttcccgtctgctatacgaatt
gacagagtatgtaagaaaacaatggagattaatggagtaacaatcccagctggagttgtc
attgtggtgccattatttgttttgcacctcaatcccgaggtctggccagaaccagaaaaa
ttccaaccagaaagatttagtaaagagaatcaaaagaaccaggacccctacagctttctg
ccttttggaactggtcccagaaactgcattggaatgagatttgccttagtaaatatgaaa
ctggccctcaccctcttgttgcagaatttcagatttgagaaatgcgaagacaccccagat
ccactgaacatttgtaccaagggatacctgaagcccacgaaacctattattctgaaactc
gttcctaaaactgcgcaaacaatgaaagaatag

DBGET integrated database retrieval system