KEGG   Xenopus laevis (African clawed frog): 495367Help
Entry
495367            CDS       T01010                                 

Gene name
cpa1, cpa
Definition
carboxypeptidase A1 (pancreatic)
Orthology
K08779  
carboxypeptidase A1 [EC:3.4.17.1]
Organism
xla  Xenopus laevis (African clawed frog)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
AA seq 420 aa AA seqDB search
MKGILVLLALVAAASSMENYSGQQVLRIFPTDEDQVNLVRALEDLEHLQIDFWTSPTKVL
LPIDIRVSFRNLQSVKVYLESNNIQYSIMIHDVQSLLDEEQNEMRRNRATENARSTDSFN
YATYHTFDEINAFIDNLVNENPNLVSKIQIGSSYEGRPLNVLKFSTGPNRPAFWIDTGIH
SREWVTQASGIWFAKKIATDYGKDASLTNTLNNIDILLEIVTNPDGYVYTHKSDRMWRKT
RSPNSGSLCVGTDPNRNWDAGFGGPGSSSNPCTETYRGRAAHSEPEVKAIVDFVKSHGNI
KGFVSIHSYSQMLLFPYGYTTARTPDHNELNTVSRNAVNALASLYGTSYTYGSIIATIYQ
ASGGTIDWTYNQGIKYSYSFELRDTGRYGFALPANQIIPTAEETWLALTKLIEHTRDNLY
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atgaagggcatactagttttactcgctctggtggcggcagcctccagcatggagaattac
agtggacaacaagtcctccgaattttccctactgacgaggatcaggtgaacctggtgagg
gcgttggaagatctggaacatttacagattgatttttggacaagccccacaaaagtcctt
ctacccattgatatccgagtttcattccgcaatctgcaatcagtgaaagtctacctggaa
tccaacaatatccagtacagcatcatgattcacgatgtacagagcttgctagatgaagag
caaaacgagatgagacgtaatcgtgccaccgagaacgcaaggtcaactgacagcttcaat
tatgctacctatcatacatttgatgagatcaacgcttttatcgataacttggttaatgaa
aatccaaatttggtcagcaaaatacagattggctcaagctatgaaggccgtcctcttaat
gttctgaagttcagcacaggtcccaaccgtccagctttttggattgacactggtatccat
tcccgtgagtgggtcactcaggccagcggtatctggtttgccaagaagattgcaacagat
tatgggaaagacgcatccttgacaaatacactcaacaatattgatatcctcttggaaatt
gtaaccaaccctgatggctatgtttacactcataaatcggatcgtatgtggcgtaaaacc
agatctcccaattctggctccctctgtgttggaactgaccccaacagaaactgggatgca
ggttttggaggtcctggctcaagctcaaatccctgtactgaaacttacagaggacgtgct
gcccattctgaacctgaagtgaaagccattgtggactttgttaaaagccacggcaacatc
aaaggatttgtctccattcacagctactcccagatgcttctcttcccatatggatacact
actgcccgaactcctgaccacaatgagctgaacactgtgtcaaggaatgctgttaatgca
ttggcctcactgtatggtacatcttacacctatggcagtatcattgctaccatctatcaa
gcaagtggaggaaccattgactggacttacaatcagggaattaagtactcctacagtttt
gagctgcgagatactggccgatatggatttgcactaccagctaaccaaatcattccaacc
gcagaggagacctggcttgcactcaccaagctgattgagcatacccgtgataacctttat
taa

DBGET integrated database retrieval system