KEGG   Xenopus laevis (African clawed frog): 495367Help
Entry
495367            CDS       T01010                                 

Gene name
cpa1, carbA, cpa
Definition
carboxypeptidase A1 (pancreatic)
Orthology
K08779  
carboxypeptidase A1 [EC:3.4.17.1]
Organism
xla  Xenopus laevis (African clawed frog)
Brite
Enzymes [BR:xla01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.17  Metallocarboxypeptidases
    3.4.17.1  carboxypeptidase A
     495367 (cpa1)
Peptidases [BR:xla01002]
 Metallo Peptidases
  Family M14: carboxypeptidase A family
   495367 (cpa1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
AA seq 420 aa AA seqDB search
MKGILVLLALVAAASSMENYSGQQVLRIFPTDEDQVNLVRALEDLEHLQIDFWTSPTKVL
LPIDIRVSFRNLQSVKVYLESNNIQYSIMIHDVQSLLDEEQNEMRRNRATENARSTDSFN
YATYHTFDEINAFIDNLVNENPNLVSKIQIGSSYEGRPLNVLKFSTGPNRPAFWIDTGIH
SREWVTQASGIWFAKKIATDYGKDASLTNTLNNIDILLEIVTNPDGYVYTHKSDRMWRKT
RSPNSGSLCVGTDPNRNWDAGFGGPGSSSNPCTETYRGRAAHSEPEVKAIVDFVKSHGNI
KGFVSIHSYSQMLLFPYGYTTARTPDHNELNTVSRNAVNALASLYGTSYTYGSIIATIYQ
ASGGTIDWTYNQGIKYSYSFELRDTGRYGFALPANQIIPTAEETWLALTKLIEHTRDNLY
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atgaagggcatactagttttactcgctctggtggcggcagcctccagcatggagaattac
agtggacaacaagtcctccgaattttccctactgacgaggatcaggtgaacctggtgagg
gcgttggaagatctggaacatttacagattgatttttggacaagccccacaaaagtcctt
ctacccattgatatccgagtttcattccgcaatctgcaatcagtgaaagtctacctggaa
tccaacaatatccagtacagcatcatgattcacgatgtacagagcttgctagatgaagag
caaaacgagatgagacgtaatcgtgccaccgagaacgcaaggtcaactgacagcttcaat
tatgctacctatcatacatttgatgagatcaacgcttttatcgataacttggttaatgaa
aatccaaatttggtcagcaaaatacagattggctcaagctatgaaggccgtcctcttaat
gttctgaagttcagcacaggtcccaaccgtccagctttttggattgacactggtatccat
tcccgtgagtgggtcactcaggccagcggtatctggtttgccaagaagattgcaacagat
tatgggaaagacgcatccttgacaaatacactcaacaatattgatatcctcttggaaatt
gtaaccaaccctgatggctatgtttacactcataaatcggatcgtatgtggcgtaaaacc
agatctcccaattctggctccctctgtgttggaactgaccccaacagaaactgggatgca
ggttttggaggtcctggctcaagctcaaatccctgtactgaaacttacagaggacgtgct
gcccattctgaacctgaagtgaaagccattgtggactttgttaaaagccacggcaacatc
aaaggatttgtctccattcacagctactcccagatgcttctcttcccatatggatacact
actgcccgaactcctgaccacaatgagctgaacactgtgtcaaggaatgctgttaatgca
ttggcctcactgtatggtacatcttacacctatggcagtatcattgctaccatctatcaa
gcaagtggaggaaccattgactggacttacaatcagggaattaagtactcctacagtttt
gagctgcgagatactggccgatatggatttgcactaccagctaaccaaatcattccaacc
gcagaggagacctggcttgcactcaccaagctgattgagcatacccgtgataacctttat
taa

DBGET integrated database retrieval system