KEGG   Xenopus laevis (African clawed frog): 495368Help
Entry
495368            CDS       T01010                                 

Gene name
cpb1
Definition
carboxypeptidase B1 (tissue)
Orthology
K01291  
carboxypeptidase B [EC:3.4.17.2]
Organism
xla  Xenopus laevis (African clawed frog)
Brite
Enzymes [BR:xla01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.17  Metallocarboxypeptidases
    3.4.17.2  carboxypeptidase B
     495368 (cpb1)
Peptidases [BR:xla01002]
 Metallo Peptidases
  Family M14: carboxypeptidase A family
   495368 (cpb1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
AA seq 413 aa AA seqDB search
MWAILLLASIAAVSAEPRSFYGEKVFRALPQNAEHVELLKSMAQIAGLDFWLPDTAELVE
QGKRADFHADSQASYEVQALLQQSGMPYEIMIDDLQEALEKQRDSNIRAVHSYEKYNDLD
TINAWSANIAAQNPGLVSRSQMGSSYEGRPIYLLKVGKSGVNKKAVFIDCGFHAREWITP
AFCQWFVKEAVNSYGVEAEFTSLLDSLDFYILPVLNVDGYVYTWTTNRMWRKTRSPNANS
SCVGTDPNRNFNAGWCTVGASSRACDETYCGAAPESEPETKALANFIRQNIGSIKGYLTI
HSYSQMLLFPYSYTYSIAKDHNELNSVAQGAVNKLTSLYRTKYTYGAGGTTIYLAAGGSD
DWAYDTGVKYSFTFELRDTGRYGFALPETQIKPTSEETLLAVKYIANHIKNNA
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
atgtgggccatactcctccttgcgagcattgcagcagtttctgctgaacccagaagcttt
tatggggaaaaagtgtttcgcgcactaccacaaaatgctgaacacgtggaacttctcaaa
tctatggcccaaatagctgggcttgatttctggctccctgacacagcagaacttgtagaa
caaggaaaacgagctgatttccatgccgatagccaagcctcatatgaggttcaggccctt
ctccagcaaagtgggatgccctatgaaataatgatcgatgatctgcaagaagccttagaa
aaacagagggacagcaacatcagggctgttcacagctatgagaaatacaatgatcttgac
acgatcaatgcttggtctgctaacattgccgctcagaacccaggacttgtgtctcgttct
cagatgggatcctcatatgaaggccgtcctatttacttgctgaaggttgggaaaagcggt
gtaaacaagaaagctgtattcattgactgtgggtttcatgctagagaatggatcacccct
gctttctgccagtggtttgttaaagaggcagtgaactcatatggcgttgaagctgaattt
acctctctgctcgacagcctggacttctacattttgccagtattaaatgttgacggttac
gtctacacctggaccactaaccgtatgtggaggaagactcgttctcctaatgcaaacagc
tcttgtgttggaactgacccaaacagaaattttaacgctggctggtgcactgttggagcc
tcatcaagagcctgtgatgaaacatactgcggcgcagctcctgaatctgaaccagagaca
aaggctttggctaacttcatccgccaaaacattggttcaatcaagggttaccttactatc
cattcctatagtcagatgttgttgttcccctattcctacacttattccattgctaaggat
cacaatgagctgaactcagttgctcagggagcagtaaacaaactgacctcactgtataga
accaagtacacttacggtgcaggaggaacaacaatctacctggcagcaggtggatcagac
gactgggcctatgatacaggtgtgaaatattccttcacctttgagctccgtgacacagga
cgatatggctttgccctccccgaaactcagatcaaacctacttctgaagaaactttgctg
gctgttaaatacattgccaaccacattaaaaacaatgcttaa

DBGET integrated database retrieval system