KEGG   Xenopus laevis (African clawed frog): 495368Help
Entry
495368            CDS       T01010                                 

Gene name
cpb1
Definition
carboxypeptidase B1 (tissue)
Orthology
K01291  
carboxypeptidase B [EC:3.4.17.2]
Organism
xla  Xenopus laevis (African clawed frog)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
AA seq 413 aa AA seqDB search
MWAILLLASIAAVSAEPRSFYGEKVFRALPQNAEHVELLKSMAQIAGLDFWLPDTAELVE
QGKRADFHADSQASYEVQALLQQSGMPYEIMIDDLQEALEKQRDSNIRAVHSYEKYNDLD
TINAWSANIAAQNPGLVSRSQMGSSYEGRPIYLLKVGKSGVNKKAVFIDCGFHAREWITP
AFCQWFVKEAVNSYGVEAEFTSLLDSLDFYILPVLNVDGYVYTWTTNRMWRKTRSPNANS
SCVGTDPNRNFNAGWCTVGASSRACDETYCGAAPESEPETKALANFIRQNIGSIKGYLTI
HSYSQMLLFPYSYTYSIAKDHNELNSVAQGAVNKLTSLYRTKYTYGAGGTTIYLAAGGSD
DWAYDTGVKYSFTFELRDTGRYGFALPETQIKPTSEETLLAVKYIANHIKNNA
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
atgtgggccatactcctccttgcgagcattgcagcagtttctgctgaacccagaagcttt
tatggggaaaaagtgtttcgcgcactaccacaaaatgctgaacacgtggaacttctcaaa
tctatggcccaaatagctgggcttgatttctggctccctgacacagcagaacttgtagaa
caaggaaaacgagctgatttccatgccgatagccaagcctcatatgaggttcaggccctt
ctccagcaaagtgggatgccctatgaaataatgatcgatgatctgcaagaagccttagaa
aaacagagggacagcaacatcagggctgttcacagctatgagaaatacaatgatcttgac
acgatcaatgcttggtctgctaacattgccgctcagaacccaggacttgtgtctcgttct
cagatgggatcctcatatgaaggccgtcctatttacttgctgaaggttgggaaaagcggt
gtaaacaagaaagctgtattcattgactgtgggtttcatgctagagaatggatcacccct
gctttctgccagtggtttgttaaagaggcagtgaactcatatggcgttgaagctgaattt
acctctctgctcgacagcctggacttctacattttgccagtattaaatgttgacggttac
gtctacacctggaccactaaccgtatgtggaggaagactcgttctcctaatgcaaacagc
tcttgtgttggaactgacccaaacagaaattttaacgctggctggtgcactgttggagcc
tcatcaagagcctgtgatgaaacatactgcggcgcagctcctgaatctgaaccagagaca
aaggctttggctaacttcatccgccaaaacattggttcaatcaagggttaccttactatc
cattcctatagtcagatgttgttgttcccctattcctacacttattccattgctaaggat
cacaatgagctgaactcagttgctcagggagcagtaaacaaactgacctcactgtataga
accaagtacacttacggtgcaggaggaacaacaatctacctggcagcaggtggatcagac
gactgggcctatgatacaggtgtgaaatattccttcacctttgagctccgtgacacagga
cgatatggctttgccctccccgaaactcagatcaaacctacttctgaagaaactttgctg
gctgttaaatacattgccaaccacattaaaaacaatgcttaa

DBGET integrated database retrieval system