KEGG   Xenopus laevis (African clawed frog): 495437Help
Entry
495437            CDS       T01010                                 

Gene name
sphk1.L, sphk1
Definition
(RefSeq) sphingosine kinase 1 L homeolog
  KO
K04718  
sphingosine kinase [EC:2.7.1.91]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
Sphingolipid metabolism
Metabolic pathways
Calcium signaling pathway
VEGF signaling pathway
Apelin signaling pathway
Module
Sphingosine degradation
Brite
KEGG Orthology (KO) [BR:xla00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    495437 (sphk1.L)
 Environmental Information Processing
  Signal transduction
   04370 VEGF signaling pathway
    495437 (sphk1.L)
   04371 Apelin signaling pathway
    495437 (sphk1.L)
   04020 Calcium signaling pathway
    495437 (sphk1.L)
Enzymes [BR:xla01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.91  sphingosine kinase
     495437 (sphk1.L)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Xenbase: 
UniProt: 
Position
9_10L
AA seq 509 aa AA seqDB search
MGDTQDSSSIPSEVILCDTFSLVPGTGSPLSLILTHKELLIQNLSLDAQLSPQYSLALTD
CIGCRSFRGKDPTDLGGYFTAVFYPLRGKALGTTVYRQRVSRTFRAEGSRDKEQNFNVAQ
SWAKKIWEMAEEQEHPGNPLPSSCRFLVLLNPFAGTGKASALFQTHVIPMLTEANATFTL
LETERPKQAYELVRDEDLSGWDAIVVMSGDGLVFEVINGLMERPDWVCAIKKPIAVLPGG
SGNALAASISYYSGHKQAVGNKLLNNCTFILCKGQPVPLDLVSFTTSSGRRIFSFLSFAW
GLISDVDIESERYRFMGSARFSFGTFVRLTALRTYRGRLSYQAAKTSVDTAPESDSHRRT
LNDSTDIVNPHVLEDSLLVPLNEPVPPHWTTVMEDQFVLVLLLYQSHLGADLFTAPMVQS
PGEGVMQLFYATSRVSRASLLKLFLAMEKGTHLHESIPHIINVPVTAFRVEPFESNGIMT
VDGEAIPCCSLQGQIHKGLGRIISIPQPS
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atgggtgatacccaagattcctcaagtatcccctctgaggttatactctgtgacactttc
tcccttgtaccaggcactggctctcccttgtcactcatcctcacccacaaggagcttctg
attcagaatctgtccctggacgctcagctgtctccccaatactcccttgccctgaccgac
tgcatcggatgccgctccttcagaggaaaagacccaacagaccttgggggttattttact
gcagtgttttacccccttagaggcaaggcgctggggacaacagtttatcggcagagagtt
tccaggacgttcagagcagaaggttcaagagacaaagagcagaactttaatgttgctcag
agctgggccaagaaaatatgggaaatggctgaagagcaagagcatcctggcaaccctctg
ccttcctcatgtcgctttctggtactactaaatccatttgcgggaaccggaaaagcctca
gccctcttccaaacacacgtgattcccatgttaacggaggccaatgccaccttcactctc
ctagagacagagaggcccaagcaagcgtatgagttggtgcgtgatgaggacctgtccggc
tgggatgccatcgttgtgatgtcaggggatgggctggtgtttgaggttattaatggtttg
atggagaggccggactgggtctgcgccattaagaagccgattgctgttctaccaggtgga
tctgggaatgctctggctgcatctatcagttactattctgggcacaaacaagcggtgggc
aacaagctgctgaacaattgtacattcatcctgtgcaagggacagcctgtacccctggat
cttgtatcttttaccacctcctctggaaggcgtatcttctctttcctcagttttgcttgg
ggtttaatctctgacgtggatattgagagtgagaggtacaggtttatgggttctgcccgt
ttctcatttggcacttttgtcagactgacggcactacgtacctatagagggcgcctctcg
taccaagccgctaaaacttcagtggacactgcaccagagagtgactcacataggcgcacc
ttaaatgattctacagatattgtgaacccccatgttttagaggactcattgcttgtccca
ttgaatgagccagttccacctcactggacaactgttatggaggaccagtttgtgcttgtc
ctgttactctaccagtcccaccttggggctgacctcttcactgctccgatggtgcagagc
ccaggagaaggggtcatgcagctgttctacgccacctctcgagtctcccgggcatcactt
cttaaactcttccttgccatggagaaagggactcacttacatgagtccatccctcacata
atcaatgtccctgttacagcatttcgggtggaaccatttgagagcaatgggatcatgact
gtggatggagaggctataccatgttgttccctccagggtcagatacataaaggtcttgga
cgcatcataagtatcccgcagccatcatga

DBGET integrated database retrieval system