KEGG   Xenopus laevis (African clawed frog): 495457Help
Entry
495457            CDS       T01010                                 

Gene name
cebpz
Definition
CCAAT/enhancer binding protein (C/EBP), zeta
Orthology
K14832  
ribosome biogenesis protein MAK21
Organism
xla  Xenopus laevis (African clawed frog)
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
AA seq 1029 aa AA seqDB search
MDALESENFRGGRNKSDIGDGADMGEDPENGFTLEEVLRLGGTKQDFIMLAGVDEGEEII
DGDKKGEIDDLEEGELQAFVEKLGIKKLSADCIGQEISAKQKEKIQAEGIKKLSADCISQ
ENSAKQKEKIQPETSNVNKSKKTIVATDNHKDLKKKKANVVQQNYADSSKATSKIKGKAV
FEFTERTILLIKPGGKWFDHEYTNNFTMQPQNEDDVSKYKSLAEKLYENERNLYKNKKEL
QKGANSSWMKTVVSTGTLGDRMAAMTVLIQDAPVHTLQFVENLVSLVRKKGSKQQNLMAL
DTIKDLLLSDLLPENRKLHTFLQHPFDKLEEACSGNRDARDRHLILWFFEEQLKKQVAEF
VKVLGTLSHDNLDATKAKSLNVAHELLCNKPEEEKSLLVLIVNKLGDPQYKIATKASYLL
ETLLSKHPNMKTVVCLEIERLLFRPNISEKAQYYGVCFLNQIIFSHEESDLANQLITVYF
CFFRACVKKKDLDSKILRALLTGVNRAYPYAQIGNEKVREQLDTLFKILHVVNFNTAVQV
LMLLFQVMDSQQTVSNRYYGALYRKLLDPGLSQASKQAMFLNLIYKSMKADVVLRRVKAF
VKRLLQVSCCQKPSFICGTLFLVSEVIRMKPGLKILLQENGENDDEECFHDLSDDDDDAC
SDGQEKTKSTTDGKISENKSTSASWVHQETLWGIKNSSNYDPFNRNPLFCGADNTSLWEL
KKLSEHFHPSVALFAKNILEGNPIQYAGDPLQDFTLIRFLDRFVYRNPKAPKVTENNRGY
LMHRRKKHYMNEEKLPVNSPVFLEKKETDIPVHEVFFHRYFTKLSKDRKKIKRSEDEESL
EDVDDEEFDKIIDSFEGDSFYSGPTDDIDFAGNLKADGKTGKKRSDADDSDDSDWDIDGE
DDDEEISLGSMCEEDFENNNDDDGDENGGIFMETENDEIPGKKTGKKKSLKQKDTFASAE
EFGDILDENTGSKFDNIGLNAMANRDNASTKQLKWEAERDNWVHNKDIKNILKRKRKFSK
QKLHKKVKK
NT seq 3090 nt NT seq  +upstreamnt  +downstreamnt
atggacgccctggaatctgagaattttcgcggcggacgcaataagagtgatatcggggat
ggagctgacatgggagaagatccagaaaatggattcactcttgaggaggttttgcgttta
gggggaactaagcaagattttatcatgctagctggcgtggatgaaggagaagaaatcata
gatggcgataagaaaggagaaatagatgatcttgaagagggagaactgcaagcatttgta
gaaaagctgggtataaagaaattgtcagctgattgtattggtcaagaaattagtgcaaag
cagaaggagaaaatacaggctgaaggtataaagaaattgtcagctgattgtattagtcaa
gaaaacagtgcaaagcagaaggagaaaatacagcctgaaaccagtaacgtaaataaaagt
aagaaaacaatagttgctacagataatcataaagatttgaagaaaaagaaagcaaatgtg
gtacagcaaaattatgcagatagttcaaaggcaacttcaaaaataaaaggaaaagcagtg
tttgaatttactgaacgaacaatattattaatcaaacctggtggaaaatggtttgatcac
gaatataccaataacttcactatgcagcctcaaaatgaggacgatgttagcaaatataaa
agcttagcagaaaaactgtatgaaaatgagagaaatttgtataaaaacaaaaaggaattg
caaaaaggagcaaattcttcatggatgaaaactgttgtttcaactgggacattgggagat
aggatggcagccatgacagtccttattcaggatgcacccgtacatacactgcaatttgtt
gagaacttggtaagcttggttaggaaaaaaggtagcaaacagcagaaccttatggccctt
gatacaattaaggatcttctactatctgatcttttaccagaaaaccgtaaacttcacaca
tttctacagcacccatttgacaaactggaagaagcctgtagtggcaacagggatgcaaga
gatcgacacctcatattatggttttttgaggaacagcttaaaaagcaagttgcagaattt
gtcaaagtgctgggaaccttgtctcatgataatttggatgccactaaggccaaatctttg
aatgtagcccatgaacttctctgtaataaacctgaagaagaaaaatctctcttagtgctg
attgtcaacaaactgggtgatcctcagtacaagattgctactaaggcatcatacctactt
gagacattgctcagtaagcatcctaatatgaaaacagtagtgtgcctagaaattgagagg
ttgttgtttcgcccaaatatcagtgaaaaagcacagtactatggagtttgtttcttaaac
cagatcattttctctcatgaagaatcagacctggccaatcaactaatcactgtatatttt
tgctttttccgtgcatgtgtcaagaagaaggacctggattctaaaatcttacgagcttta
ttgacaggagtaaatagagcttatccttatgcgcagataggaaatgaaaaggtcagagag
cagcttgataccctttttaaaatattgcacgttgttaattttaacacagcagtacaggtc
ctcatgctgctttttcaagtaatggactctcaacagactgtgtcaaaccgatactatgga
gcactatatagaaaactactggatcctggtctctcacaggcctccaagcaagcaatgttt
ctaaaccttatttacaagtctatgaaagctgatgtagtactaagacgtgtaaaggcattt
gtgaaaagattactgcaagtttcatgttgtcagaagccatcatttatttgtggtaccttg
tttctcgtatcagaggttataagaatgaagccaggtctgaaaattctgctacaagaaaat
ggggaaaatgatgatgaagagtgttttcatgacctttctgatgatgacgatgatgcttgc
agtgatgggcaggaaaaaacaaagagtaccactgatgggaaaatatcagaaaataaatct
acctcagcttcttgggtgcatcaggaaacactttggggtataaagaattccagtaattat
gacccctttaatagaaaccctttattttgtggagctgataacacaagcctttgggagcta
aaaaagctctctgaacactttcatccatctgttgcactttttgcaaaaaacattttagag
ggtaatcctatccaatatgcaggggacccacttcaagatttcacattgattagatttctt
gatcgttttgtatatcggaatccaaaagcaccaaaagttacagaaaacaacagaggttat
ttaatgcaccgaaggaagaagcattatatgaatgaggagaagcttccagttaacagccct
gtattcctggaaaagaaagaaactgacattcctgtgcacgaagtattctttcaccgatac
ttcacaaagttgtctaaagatagaaagaagattaaacgaagtgaagatgaagagagctta
gaagatgtcgatgatgaggagtttgacaaaattatagactcatttgaaggagacagtttt
tatagtggacccactgatgatattgatttcgctggaaacttaaaagcagatggtaaaaca
gggaagaaaagatcagatgctgatgactccgatgattccgattgggatatcgatggagaa
gatgacgacgaagaaatttccttgggtagtatgtgtgaagaggactttgaaaacaataat
gatgatgatggtgatgaaaatggaggcatttttatggaaaccgaaaatgatgaaatccca
ggaaaaaagacaggaaagaagaaatctttaaaacaaaaggacacatttgcttctgcagag
gagtttggagatattcttgatgaaaacacaggatcaaaatttgacaatataggattaaat
gctatggcaaatagagataatgcaagtactaagcagctcaagtgggaagcagaacgagac
aactgggtacacaataaggatattaaaaatattctcaaaagaaaaaggaaattcagtaaa
caaaagctgcataaaaaagttaaaaaataa

DBGET integrated database retrieval system