KEGG   Xenopus laevis (African clawed frog): 495685Help
Entry
495685            CDS       T01010                                 

Gene name
pcmt1
Definition
protein-L-isoaspartate (D-aspartate) O-methyltransferase
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
xla  Xenopus laevis (African clawed frog)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
AA seq 228 aa AA seqDB search
MAWKSGGASHSELVNNLRKNGIIKSDRVFEVMVETDRRHYAKCNPYMDSPQSIGYQATIS
APHMHAYALELLHDQLHEGAKALDVGSGTGILTACFSRMVGPKGKVVGIDHIKELVDDSV
NNVKKDDPTLLSSGRVKLLVGDGRMGYPEEAPYDAIHVGAAAPVVPQALIDQLKPGGRLI
LPVGPAGGNQMLEQYDKLEDGSVKMKPLMGVIYVPLTDKDKQWSRDEL
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atggcctggaagtcaggaggagccagccactcggagctggtcaataacctgcgcaaaaat
ggaattatcaaatcagatagagtgttcgaagttatggttgaaacagatcgccggcattat
gcaaaatgcaatccatacatggactctccacagtcaataggttaccaagcaacaattagt
gcaccacacatgcatgcttatgccctagaacttcttcatgatcagttacatgaaggtgcc
aaagctcttgatgtaggatctggaactggaattcttactgcatgtttttcaagaatggtt
ggcccaaagggaaaagtagtagggattgaccatatcaaagaattagtagatgattctgta
aataatgtaaaaaaagatgacccaaccttattgtcttcaggccgagtgaagctattagtt
ggagatgggagaatgggttacccagaagaagcaccgtatgatgctattcatgtaggagca
gctgcacctgttgtaccccaagctcttatagatcaacttaaaccaggaggaagattaatc
ttacctgttggtccagctggtggaaaccaaatgttggaacaatatgataagctagaagat
ggaagtgtcaaaatgaagcctttgatgggggtgatctacgtgcctttaacagacaaagat
aagcagtggtccagggatgaattgtaa

DBGET integrated database retrieval system