KEGG   Xenopus laevis (African clawed frog): 495686Help
Entry
495686            CDS       T01010                                 

Gene name
usp47
Definition
ubiquitin specific peptidase 47 (EC:3.4.19.12)
Orthology
K11857  
ubiquitin carboxyl-terminal hydrolase 47 [EC:3.1.2.15]
Organism
xla  Xenopus laevis (African clawed frog)
Brite
Enzymes [BR:xla01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     495686 (usp47)
Peptidases [BR:xla01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   495686 (usp47)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
AA seq 1350 aa AA seqDB search
MRPGEESQLVPKEIENAADEPRVLCIVQDTTNCKSVNERITLNLPASTSVKQLYEDVSNK
AGYVSSTFSLMWGNGASNTDMAALDPTPDRTLQEAGFEAGKKNFLHLTDKDGEQPQLTSD
ESGTADSSGLDDSSQEKFIGPLPREESVAGTSNYVSQNYSYSSLLSKSDTGYVGLVNQAM
TCYLNSLLQTLFMTPEFRNALYKWEFEESEEDPVSSIPYQLQRLFVLLQTSKKRAIETTD
VTRSFGWDSSEAWQQHDVQELCRVMFDALEQKWKQTEQADLINQLYQGKLKDYVKCLECG
YESWRIDTFLDIPLVIRPYGSNTAFGSMEEALHAFIQPETLDGPNQYFCERCKRKCDARK
GLKFLHFPYLLTLQLKRFDFDYTSMHRIKLNDRMTFPDELDMSPFIDMEDEKSPQTDSCT
DSGAENEGSCHSDQMSNDFSTDDAVDEGICLETNSNIEKLNKSVAEKNSLYELFSVMVHS
GSAAGGHYYACIKSFADGQWYSFNDQHVSRITQEDIKKTYGGATGNRGYYSSAFASSTNA
YMLMYRLKNPARNAQFLEASEFPEHIKLLVQKEQEQEEQEKRQREIERNTCKLKLFCMHP
VKQIMMESKLEVHKDKTMKEAVEIANKLMDLEGVIPLDCCRLVKYDEFHDYLERSYEDEE
DRTMGYLLGGVKSSYMFDLLLETKRPDQVFQSYKPGEVMVKVYVVDLKTETVASPVSVRA
YLSQTIIEFKQLISKSVDLPPDSMRVILERCYNDLRLLNVANKTLKAEGFFRSNKVFVES
SDSLDHQLVFTDSHLWKLLDRHANTIKLYVSLPEHPRPTARSVGPKGGGDMNPQEDYCSR
AKSVDAILEESTEKLKSLSLQQHQDGGNGDSSKSTEGSDFENIDSPLNEVDSSGSADNRE
LENRILPADPENNFQPEERSDSDVNNDRSTSSVDSDILSSSHSSDTLCNADGTPIPLANG
LDSHSITSSRRSKANDGKKETWDTAEEDSGTDSEYDESGKSRGEAQYMYFKAEPHAGEGC
LAEGSKCLLVNVDKRITLAAFKQQLESFVGVPSSQFKVFRVYASNQEFESVRLNETLSSF
SDDNKITIRLGRALKKGEYRVKIFQLLVNEPEPCKFVLDAVFSKGMTVRQSKEELLPLLR
EQCGLDLSIDRFRLRKKTWKNPGTVFLDSHVYENESISSCWEVLLEALDETEKMKSMSQL
SLFTKRWRPSELKLDPFKEVVLESNSVEELRDKICEISAIPLENLEFAKGRGTFPCDISV
LEIHQDLDWNPKVSTLNAWPLYISDDGAVIFYRDKTEEVMELTDEQRNELVKKESSRLQK
TGHRVTYSPRKEKALKIYLDGPTNKDSAQD
NT seq 4053 nt NT seq  +upstreamnt  +downstreamnt
atgaggcctggagaagagagtcagctggtgcccaaagagattgaaaatgcagccgacgag
ccaagagtactgtgcatcgtgcaagacaccaccaactgcaagagcgtaaacgaacgaatc
acgttaaacctcccggcgtccacctcggtgaaacaactgtacgaagacgtgtccaataag
gcgggatatgtttccagcacgttcagtctgatgtgggggaatggagccagtaacactgac
atggcggcgctggatccaaccccagacaggactttgcaagaggccggatttgaagcagga
aagaaaaacttccttcatttgacagataaagacggggaacagccacagctcacgtcggat
gaatcagggacagcagacagcagtgggctcgacgacagctctcaggagaaattcatcgga
ccattacccagagaagagtctgtggccggcacaagcaactatgtcagccagaactactcg
tactcctcccttctcagcaagtctgatacaggttacgtgggcctggtgaaccaagcgatg
acttgttacttgaacagcctcctgcaaaccctcttcatgaccccagagttccggaatgcg
ctgtacaagtgggagtttgaggagtcagaagaagatccagtctccagcatcccgtaccag
ctgcaaagactctttgttttactgcagacgagcaaaaagcgagcgatagaaaccacagac
gtgactcgcagctttggctgggacagcagtgaagcttggcagcagcatgacgttcaggaa
ctgtgccgggtcatgttcgatgctttggaacaaaaatggaagcagacagaacaggctgac
ctcatcaatcagctgtatcaaggaaagctaaaggactacgtgaaatgcttggaatgcggc
tacgaaagctggaggatcgatacgttccttgatattcctctagtcatccggccatacggc
tctaacacagcgtttggtagtatggaagaagcacttcatgcgtttatccagccggagacc
ctagatggacccaatcagtacttctgtgagcggtgcaagaggaaatgcgatgcacggaag
ggcctgaagttcctgcattttccatacctccttactctgcagctcaagaggtttgatttt
gattacaccagcatgcacaggatcaaactgaatgatcggatgacgtttcccgacgagcta
gacatgagcccgttcatagacatggaagacgagaagtctcctcaaacggatagctgcaca
gatagtggtgctgaaaatgagggcagttgccatagtgaccaaatgagcaacgatttttcc
actgatgacgcagttgatgagggaatctgtctggaaacaaacagcaatattgaaaagctg
aataaatctgtagcagaaaagaattccttgtatgaacttttttccgtgatggtccattca
gggagtgcagcggggggacattactacgcctgtataaaatcctttgctgatggccagtgg
tacagcttcaatgatcagcacgtaagcaggataacacaagaggacattaaaaaaacttat
ggtggggctacgggaaaccgcggctactactccagtgcctttgctagctctacaaatgca
tacatgctgatgtacagactgaagaacccagctagaaatgcacaattccttgaagcgagt
gaatttcctgagcacataaaacttctcgtgcaaaaggagcaggaacaggaagagcaggag
aagcgccagcgagagattgaacgcaacacatgcaaactcaagcttttctgcatgcacccg
gtcaagcagatcatgatggaaagtaaacttgaagttcacaaagataaaaccatgaaagaa
gccgttgagattgcgaacaagctcatggacttggaaggcgtgatccctctcgactgctgc
cggctagtgaagtatgatgaatttcacgattacctggagcgctcctacgaagacgaggag
gaccggacgatgggatatctgcttggaggcgtcaaatcgtcttatatgttcgacctattg
ttagaaaccaagagaccagaccaagtatttcagtcctataaacctggtgaggtcatggtc
aaagtgtacgtggtggatctaaagaccgaaaccgtagcttctcccgttagcgtccgcgcc
tatcttagtcagaccatcatcgagttcaagcagcttatctctaagagtgtcgatttgccg
ccggacagcatgcgcgttatcctggagcgatgttacaacgacttgcgccttttaaacgtg
gcgaataaaaccttgaaagcagaaggattcttcagaagcaataaggtgtttgtggaaagc
tccgactctctagaccaccagctggtttttaccgactctcatctgtggaaactcttggac
cgccacgccaacaccatcaagctttatgtgtctttacctgagcacccccgtccgacggcg
aggtccgtcggtccgaaagggggcggggatatgaatcctcaagaggactactgcagcagg
gcgaaatcggtggatgccattctggaagagagcacagagaagctaaagagcctgtctctt
cagcagcaccaagatggcggcaacggggacagcagcaagagcaccgaggggagcgatttc
gagaacattgattcgccactgaatgaggtggattcttcagggtcagccgacaaccgagaa
ctggaaaaccgaatcttgccggctgaccccgagaacaactttcagccggaagagcggtcg
gactctgacgtgaacaatgaccggagcaccagctcagtggatagcgatatcctcagctca
agccatagcagcgatactttgtgcaacgcagacggcacccccatccccctcgcaaatgga
ctcgactcccacagcatcaccagcagcaggcgatccaaagccaacgacggcaagaaagag
acgtgggacactgccgaggaggattctgggaccgatagcgagtacgacgagagcggaaaa
agcaggggagaggcgcaatatatgtattttaaagcggagccacatgcaggggagggttgc
ttagcggaaggaagtaaatgcctcctggtaaacgtggataagaggatcaccttagctgcc
ttcaaacagcaactggagtcttttgtgggtgtgccctcctcccagtttaaagttttccgg
gtctatgccagcaatcaggaatttgagagcgtccggctcaatgagacgctttcttctttt
tcagatgacaacaagatcaccatcagactcgggagagctctgaaaaaaggggaataccgg
gtcaaaatctttcagcttttagtaaacgagcccgagccttgcaagtttgtgttggacgca
gtgttttctaaaggaatgaccgtgcgacagtccaaagaggagctgttgccgctactcagg
gagcagtgtgggctggatctttctatagacaggttccggctgcgaaagaaaacgtggaag
aacccagggacagtatttctggattcccatgtttacgagaatgaaagtatttcgagctgc
tgggaggttttgttagaagcgctggacgaaactgagaaaatgaagtccatgtcgcagctc
tccttgtttacaaagaggtggaggccgtcggagttaaagctggacccctttaaggaggtt
gtgctggaaagtaacagcgtggaggagttaagagacaagatttgtgagataagtgctata
cccttggagaacttagaatttgctaagggtcgaggcacgttcccctgtgacatttccgtt
ttggagatccatcaggatttggactggaatcctaaagtgtcgacgctgaatgcttggccg
ctgtacatttcagacgatggagccgtcatattttaccgggataaaaccgaagaagtgatg
gaactgacggacgagcagagaaacgaattggtgaagaaggaaagcagccgcctgcaaaag
accggacaccgcgtcacctactccccccgaaaggaaaaagcactaaaaatatacctagac
gggccgaccaataaagactcggcgcaagactga

DBGET integrated database retrieval system