KEGG   Xenopus laevis (African clawed frog): 495689Help
Entry
495689            CDS       T01010                                 

Gene name
crebbp-b, cbp, crebbp, kat3a, p300, rsts
Definition
CREB binding protein (EC:2.3.1.48)
Orthology
K04498  
E1A/CREB-binding protein [EC:2.3.1.48]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
FoxO signaling pathway
Cell cycle
Wnt signaling pathway
Notch signaling pathway
TGF-beta signaling pathway
Adherens junction
Jak-STAT signaling pathway
Melanogenesis
Herpes simplex infection
Brite
KEGG Orthology (KO) [BR:xla00001]
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    495689 (crebbp-b)
   04330 Notch signaling pathway
    495689 (crebbp-b)
   04350 TGF-beta signaling pathway
    495689 (crebbp-b)
   04630 Jak-STAT signaling pathway
    495689 (crebbp-b)
   04068 FoxO signaling pathway
    495689 (crebbp-b)
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    495689 (crebbp-b)
  Cell communication
   04520 Adherens junction
    495689 (crebbp-b)
 Organismal Systems
  Endocrine system
   04916 Melanogenesis
    495689 (crebbp-b)
 Human Diseases
  Infectious diseases
   05168 Herpes simplex infection
    495689 (crebbp-b)
Enzymes [BR:xla01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     495689 (crebbp-b)
Transcription factors [BR:xla03000]
 Eukaryotic Type
  Other transcription factors
   Pocket domain CBP
    495689 (crebbp-b)
Mitochondrial biogenesis [BR:xla03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Coactivators
    495689 (crebbp-b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
AA seq 2428 aa AA seqDB search
MAENLLDGPPNRKRPKLSSSGFSASTDSTDFSFFDLENDLPDELIPNGGELSILGTGGNL
GQDAASQNKQLSDLLRGGNAGLGAAMGRGGSGSPVHQGMGSQQNSPGLGNLSNLNKSPLN
QGLSVTPPSGLTKTTTGTPGPSVPASQAQKQVSMVAGSPAAPQAPTGICMNSNFNQGHQA
LLNSNSGHTLINQAQPAQGQVLNGSLGVGSRGRGTALQYNSPGMQTNPGSVLAETLTQGT
ATMPTHAGMTTAQSGAMTKMGLPGNTSPFGQTFNQAAGQQIRAQGVNPQLPAKPAMANSL
PSFPSDIKNAPAANVANMAQVQQVGIGTTPSMGTGPTADPEKRKLIQQQLVLLLHAHKCQ
RREQANGEMRDCSLPHCRTMKNVLNHMTHCQAGKACQVAHCASSRQIISHWKNCTRHDCP
VCLPLKNASDKRNQNLPVSLASGVQNPIGTAGAGQPTAPSLSSPNPIDPSSMQRAYAALG
LPYGNQAQSTGQQSAQTQVHQQIRNMNALGGNQINLTAGGMAVEQQTNLISEAALPTALT
NSNSLLSDGNSPSTVGNLGTMPTAAPPSATGVRKAWHEHVTQDLRNHLVHKLVQAIFPTP
DPAALKDRRMENLVAYARKVEGDMYESANSRDEYYHLLAEKIYKIQKELEEKRRSRLQKQ
GIVSSQTPLQAPGTQPTALTQTTAALGQTPSVRPTNGPISMSTVPTMNRMQVASGMNQFS
SMTIGNVQMPTAPMGPRAASPLNHPTQMNNMGTVPAMAMSPSRMSQPQTIIGAHAGSMIG
PTQTQSQFLQQNQFPASTGTISVGLGQTGAAAAVSQQGQAPTASLPISNSMNMLGPQTSQ
LQRPALSQSPLHQTPPSVTVSAVMPPVQHPAPAAMTPPQPTAPAQPSTPLPTPGQTPAPM
PGSVPNSMQSQSTPTVQAAAQTQLTPQPSTPVPIQSVPTPQPAQLQPTSVHAPAPGTPLS
QAAASVDNHVRTPASVASTENQPAPDHIMTEVKVECKMEEPEVCENQVEPKTEVEPEAPS
QVKETVSEGPEMKSEPMEVEEKKTEIKTENKEEEENGGANSSLQSTSPSQPRKKIFKPEE
LRQALMPTLEALYRQDPESLPFRQPVDPQLLGIPDYFDIVKNPMDLSTIKRKLDTGQYQE
PWQYVEDVWLMFNNAWLYNRKTSRVYKYCTKLAEVFEQEIDPVMQSLGYCCGRKFEFSPQ
TLCCYGKQLCTISRDAAYYSYQNRYHFCEKCFTEIQGENVTLGDDPSQSQTTISKEQFEK
KKNDMLDSEPFVDCKECGRKMHQICVLHYDIIWPSGFVCDNCLKKTGRTRKENKFCAKRL
QTTRLGNHLEDRVNKFLRRQNHPEAGEVSVRVVASSDKIVEVKPGMKSRFVDTGEMPESF
PYRTKALFAFEEIDGVDVCFFGMHVQEYGSDCPMPNTRRVYISYLDSIHFFRPRSLRTAV
YHEILIGYLEYVKKLGYVTGHIWACPPSEGDDYIFHCHPADQKIPKPKRLQEWYKKMLDK
AFAERIIHDYKDIFKQATEDRLTSAKELSYFEGDFWPNVLEESIKELEQEEEERKKEEST
AACETIEGCQGDSKNAKKKNNKKTNKNKSSMSRSNKKKIIMPNVCNDLSQKLYATMEKHK
EVFFVIHFYAGPVINSLPPIVDPDPLLSCDLMDGRDAFLTLARDKHWEFSSLRRSKWSTL
CMLVELHTQGQDRFVYTCNECKHHVETRWHCTVCEDYDLCVNCYSAKNHEHKMVKWGLGL
DDESNGQGDAQSKSPQESRRLSIQRCIQSLVHACQCRNANCSLPSCQKMKRVVQHTKGCK
RKTNGGCPVCKQLIALCCYHAKHCQENKCPVPFCLNIKQKLRQQQIQHRLQQAQLMRRRM
ATMNTRAVPQQSLPSPTSATPGTPTQQPSTPQTPQPAPQPSPVSKASPSFPSVQRTQTPI
VASQGKPTNPVPPVPPSQPTVQPPPAAVAAARQIELEAQQQQLYRVTGIAEGMTSARPGM
VNPSVGSVNPMQQMGMNVPRPSPIGAPPIIAGMQPGQWPAAQLPQQPQMQQNIQRPVMQM
ATAQQAVAGPRLAGVPPQQARNIAPAPNALQDLLRTLKSPSSPQQQQQVLNILKSNPHLM
AAFIKQRTAKYVANQPAMQPQQAPQQQPQQPGMHPQAGLQNMSPMPVGVPRAAVPQQQPG
MTPQGQGIGLMNTAHNTNLANMNPQYREMYHRRQQLLQQQQQQQQQQQQQSGVGMAGGLP
AHGQFQQPQGAYPQPQALQQQRLQQQHLSIQGGTMGQISQMAQPGLGNEGSQASLQHALH
QRIQQQIKQQIASGQANAMSPQQHLLTGQPPSAHLATGQQIATALSNQVRSPAPVQSPRP
QSQPPHSSPSPRVQPQPSPHHVSPQTGSPHPGLAASMANSLDQGHLGNPEQSAMLPQLNP
PNRSALTNDLSLVGDTSGDTLEKFVEGL
NT seq 7287 nt NT seq  +upstreamnt  +downstreamnt
atggccgagaacctgctggacgggccacccaacaggaagagacccaaactgagctcatca
ggcttctctgctagcactgacagtacagacttttccttctttgacttggaaaacgacctc
cccgatgaactaattcccaatggaggagaactaagcattttgggtactggggggaacctg
ggtcaagatgcagcttcccaaaataagcaactgtccgatctcctacgtggtggaaatgca
gggcttggtgcagctatgggcagaggaggctctggcagtccagtgcatcagggaatggga
tcccaacaaaatagccctggacttggaaatcttagcaatcttaacaagagcccactcaat
cagggcctatctgtcactccaccctctggacttaccaagacaacaacggggacacctggt
ccatctgttcctgcctcccaagcacaaaaacaagttagtatggtggcaggcagcccggct
gctccacaggcacctacaggcatctgcatgaactccaatttcaaccaagggcatcaggct
ctgctcaatagtaactctgggcacacactaataaaccaggcccagccagcacagggacag
gtcctcaatgggtctttaggtgtgggaagcagaggtcggggaactgccctacagtacaac
tcacccggcatgcaaactaatccaggaagtgtcttggcagaaacattaacacaagggaca
gcaaccatgccaactcatgcaggaatgacaactgcccagagcggagccatgactaaaatg
ggacttccaggcaacactagtccttttgggcagacatttaaccaagccgctggtcagcaa
atccgagcccaaggagtcaaccctcagctgcctgcaaagcctgccatggcaaacagcctt
ccttcttttccttctgacatcaaaaatgcacctgctgctaatgttgccaatatggctcag
gttcagcaagttggtattggcacaacgccatccatgggaactggcccaacagctgacccg
gagaagcgcaagcttatacagcaacaacttgtcctactgcttcatgcgcacaagtgtcag
cggcgagagcaggctaatggtgaaatgagggactgctccctgccccattgtcgcaccatg
aagaacgtgcttaatcacatgacccattgtcaggccgggaaggcttgccaagttgcccac
tgtgcttcctcaagacaaatcatctctcactggaaaaattgtacgcggcatgactgtcct
gtgtgcctgccattaaagaatgccagtgataagcggaatcagaatctcccagtttcttta
gcaagtggagtacaaaaccccattgggacagctggagcaggccagcctactgctccttca
ttaagcagcccaaatcctatagatcccagctccatgcagcgagcatatgctgcgctcgga
cttccctatgggaatcaggctcaaagcacggggcagcagtcagcgcagactcaggttcat
cagcagattcgtaacatgaatgcactaggtggtaaccagataaatcttacagcgggagga
atggctgttgaacagcaaacaaatctgatctctgaagctgctctgcccactgccttgaca
aactcaaactcattgctgagtgacgggaacagcccaagtacagttggtaaccttggcact
atgcctacagcagcacccccttcagctacaggagtgagaaaagcatggcatgaacatgtg
acccaggatctccgcaatcaccttgtacataagctagttcaggcgatcttccccactcca
gaccctgcagccctgaaggaccggcgcatggaaaatttagtggcatatgctagaaaagtg
gaaggagatatgtatgagtcagccaacagcagggacgagtattatcatttactggctgag
aaaatatataaaatacaaaaggaacttgaggagaagcgaaggtcgcgtttgcagaaacaa
ggaattgtgagcagccagacacccttacaagcccctggaacacaacctacagcccttaca
cagaccacagctgcactgggacagactccatctgtgcggccaaccaatggcccaatctcc
atgtctacagtacctactatgaaccgcatgcaggtagcttcagggatgaaccagttcagt
agtatgaccattgggaatgttcaaatgcccacagctcctatgggtccccgtgcagcatct
ccactcaaccaccctacacagatgaacaacatgggaacggtaccagctatggccatgtct
ccatcccgaatgtcccagccgcagactataataggtgcacatgcaggcagtatgataggg
ccgacacaaacacagagccaattcttgcaacagaatcaattcccagcaagcactggcacc
atatctgtgggactggggcagactggagcagcagctgcagtttctcagcagggacaagca
cccactgcatctctgcctatcagcaactcaatgaacatgttgggcccacagacgagtcag
cttcagcgaccagcactttcccagtcgccccttcatcaaactccaccttctgttactgtt
tctgccgtcatgcccccagtacagcaccctgctccagctgctatgacccctccccaaccc
actgcacctgctcagccatccactccgctgcctactcctgggcagacacctgctccaatg
cctggctctgttcctaattccatgcaatcacaaagcaccccaacagtgcaagcagcagcc
caaacgcagctcactccacagccgtcaacacctgtgcccattcagtctgtacccacgcca
caacctgctcagctgcaacctacgtccgtgcatgcaccagctcctggcactccgttatca
caggcagcagcaagtgtagacaatcatgtgcggaccccagcttctgttgccagcactgaa
aaccagccagctccggatcatattatgacggaagtgaaagtagaatgcaaaatggaggag
ccagaggtgtgtgaaaaccaagtggagcccaaaacagaggtggaaccagaagctccatct
caagtgaaggaaactgtgagtgagggtcctgagatgaaatcggagccaatggaagtggag
gaaaagaaaactgaaataaaaacggagaacaaagaggaggaagaaaacgggggcgccaac
agttcccttcagtccacttcaccttctcagccgcggaagaagatttttaagcctgaagaa
ctgcgccaagctctgatgcccacacttgaagccttatatcgacaggatccagaatcctta
ccctttcgtcagcctgttgatcctcagctgctgggaataccagattactttgacattgtg
aaaaaccctatggacttgtccaccattaaacgaaagcttgacactggacagtaccaggag
ccatggcagtatgttgaggatgtctggctaatgtttaacaatgcctggctgtacaataga
aagacctcccgcgtctacaaatactgcactaagcttgccgaagtctttgaacaggagata
gatcccgtcatgcagtctcttggctattgttgtgggcgcaagtttgagttctctcctcaa
acactatgctgctatgggaagcagctctgtaccatttcacgtgatgctgcctactacagc
tatcagaatagataccacttctgtgaaaagtgcttcacagaaatccaaggggagaatgta
actttaggagatgatccttcccaatcgcaaacgacgatatccaaggagcaatttgagaaa
aagaaaaacgatatgcttgactcagagccttttgtggactgcaaagagtgtggaaggaag
atgcatcagatctgcgtcctgcattacgatattatttggccatctggctttgtctgtgat
aactgcttgaaaaaaacagggaggacacgaaaagaaaacaagttttgtgcaaagaggctc
caaaccacccggctaggaaatcacctggaagatcgagtgaataagttcttgcggagacag
aatcatccagaggctggggaagtgtccgtaagggttgtggcaagttcggataagattgtg
gaagtgaaacctggaatgaaatccaggtttgtagacactggagagatgcctgaatccttc
ccataccgtacaaaagctctgttcgcttttgaggagattgatggtgtagacgtgtgtttc
tttggcatgcacgtacaagaatacggctctgactgtcctatgcccaacaccagacgggta
tacatctcctatctggacagtattcacttcttcaggccacgtagccttcgaactgctgtc
taccatgagattctcattggttacttggaatatgtgaaaaaacttggctatgtcacaggg
catatctgggcctgcccaccaagtgaaggggacgactacatcttccattgccatccggct
gaccaaaaaatccccaagcctaagcgtctgcaggagtggtataaaaagatgctggacaag
gcttttgctgagcgcatcattcatgactataaggacatctttaagcaagcaaccgaggat
cgtctcactagtgccaaggaactttcatattttgaaggagatttctggcctaatgtgtta
gaggagagcatcaaggaacttgagcaggaagaagaggagagaaagaaggaagagagtaca
gctgcttgtgagaccattgagggctgccaaggagatagcaaaaatgccaagaaaaaaaat
aacaaaaagaccaacaaaaataaaagcagtatgagtcgctccaacaagaaaaaaatcatc
atgcctaatgtttgtaacgatctcagccagaagctctatgccactatggagaagcataaa
gaggtgttttttgtgatccatttctatgcggggccagttattaattccctcccacccatt
gtggacccggacccactcttgagctgtgacctaatggacggaagggatgcattcctgact
ctagcccgtgataagcactgggagttctcatctctgcgacgttccaagtggtccactctt
tgcatgctggtggaattacacacgcaaggccaggaccgctttgtctacacctgcaatgaa
tgcaaacatcatgtggagacacgctggcactgcacagtatgtgaggattatgatctgtgt
gtgaactgctacagtgcaaagaaccatgagcacaagatggtgaaatggggtcttgggctg
gatgatgaaagtaacggccagggtgatgcacagtctaagagtccacaggagtcccgtcgg
cttagcattcagagatgcatccagtccttggtgcatgcctgtcagtgtcgcaatgccaat
tgttcccttccctcgtgccagaagatgaagcgggtggtacagcacaccaagggatgcaag
cgcaagacgaatggtggctgccctgtttgcaagcagttgattgccttgtgttgctaccat
gctaagcactgccaagagaacaaatgcccagtgcccttctgtctaaacattaaacaaaag
ttaagacagcaacagatccaacaccggctgcagcaggctcaacttatgcgacgacggatg
gccactatgaatacacgagctgttccgcagcagagcctcccatcccctacctcagcaaca
cctggaacacctacacagcagccgagcaccccgcaaactccacagcctgctccacaacca
tctccagtaagcaaagcttccccaagcttccccagtgttcaaaggactcagactccaatt
gtagcatcacagggcaagccaacaaatccagttccacctgtgcctccctctcagcccact
gtgcagcccccaccagctgctgtggcagctgcccggcaaatagaattagaggcacaacag
cagcagctgtacagggtgaccggcattgcagaagggatgactagtgcacgtcctggcatg
gtcaacccatctgttggatctgtgaaccccatgcagcaaatgggtatgaatgtgccacgc
cccagtcccattggtgcaccccctatcattgcaggaatgcagcctgggcagtggccggca
gctcaactccctcagcaacctcaaatgcagcagaacatccagcgaccagtgatgcaaatg
gccactgcacagcaggcagttgcaggacctcgtttggcaggcgtacccccacagcaggca
cgtaatatagcacctgcacccaatgccttgcaggatctgctgcgtaccctcaaatcacca
agctctccacaacagcagcagcaggtgcttaatattttgaagtccaatccacacctaatg
gcagcttttattaagcaaaggactgctaaatatgtggccaatcagcctgcaatgcagccc
cagcaagcaccccagcagcagccgcaacaacctggcatgcatccacaagctggcctgcag
aacatgagccccatgccggttggagtgccgagggcagctgttcctcagcaacagccaggt
atgactccacaaggtcaaggtattggcttgatgaacaccgctcataatactaacctggca
aatatgaacccgcagtaccgggagatgtatcatcgacgacaacaactgttgcagcagcaa
caacaacaacaacagcagcagcaacagcagagtggagtaggtatggctgggggattgcca
gcccatgggcagttccagcaaccccagggagcatacccgcaaccacaagccttgcaacag
caacgcctgcagcagcagcatctatctatccagggaggtaccatgggacagatttcacag
atggcacagccgggacttggcaatgaaggttcacaggcaagtctccagcatgctttgcat
caacgtatccagcagcagatcaagcaacaaattgcttcaggacaggctaatgctatgagc
ccacagcaacaccttctgactggccaacccccctctgcccatttagccactggccagcaa
attgcaactgctctaagtaatcaggtgcgctcaccagcccctgtccaatcacctcggcct
cagtcacagcctccacattccagcccttcaccccgtgtacagcctcagccctccccgcac
catgtttcaccccagacaggctctccccaccctggcttggcagcctctatggctaactcc
ctagaccagggtcatttgggaaatccagagcagagcgccatgcttccgcagctcaacccc
cccaatcgtagtgccctaacaaatgacttgtcccttgtcggagacacttcaggggacacc
ttggaaaaatttgttgaagggttgtag

DBGET integrated database retrieval system