KEGG   Xenopus laevis (African clawed frog): 495825Help
Entry
495825            CDS       T01010                                 

Definition
uncharacterized LOC495825
Orthology
K00709  
histo-blood group ABO system transferase [EC:2.4.1.40 2.4.1.37]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
Glycosphingolipid biosynthesis - lacto and neolacto series
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xla00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00601 Glycosphingolipid biosynthesis - lacto and neolacto series
    495825
Enzymes [BR:xla01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.37  fucosylgalactoside 3-alpha-galactosyltransferase
     495825
    2.4.1.40  glycoprotein-fucosylgalactoside alpha-N-acetylgalactosaminyltransferase
     495825
Glycosyltransferases [BR:xla01003]
 Glycan extension
  ABO blood group
   495825
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 338 aa AA seqDB search
MAGIFVLGWYKPKASSTWYPHYLFSCKANNSELSIYFRSSQDNLKAVQLKRILYPKAETL
KPQRTDVLSVSPWLAPIVWEGNFNIDILNEQFHQRDVRIGLTVFAIKKYIRFLKTLIETA
EKFFMVGHQVNYYVFTDLVRNVTNFNITVGTGRRLVFLEVPSYKRWQDVSMRRMQMIRDA
SQQRFAYEVDYLVCIDVDMRFQDHVGVEILSDVFGTLHPAFFVKTRHQFTYERRPQSQAY
IPEDEGDFYYAGGYFGGKIEEVYKLTNHCHHAMLTDKANNIEAVWHDESYLNNYFLYYKK
PTKILSPEYLWNERDGTAHYLRKRRLIALHKNPDEVRN
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atggcagggatttttgtattaggctggtacaagccaaaggcctcctctacatggtacccc
cactacctcttttcctgcaaagcaaataactcggagttgtccatttacttcagatcaagc
caagacaacttaaaggcagtccagcttaaaagaatattgtatccaaaagctgaaacccta
aagccacagagaaccgatgttctgtctgtatccccctggctggccccaatagtgtgggaa
ggcaatttcaacattgatatactgaatgaacagttccaccagagagatgttcgcattggc
cttacagtgtttgccattaaaaaatacataagatttctcaaaacgctcattgaaacagct
gagaagttcttcatggtgggacaccaagtcaactactatgttttcactgatctagtaaga
aacgtaactaattttaacattacagttgggacgggaaggcgacttgtcttcctcgaggtc
cccagttacaaacggtggcaggatgtctccatgcggcgcatgcagatgattcgagacgct
tctcaacagagatttgcctatgaggtggactatttagtgtgcatagatgtagatatgagg
tttcaagaccatgttggagtagagattctcagtgatgtgtttgggactttacacccggcg
ttcttcgttaaaactaggcaccaatttacttatgaacgtaggcctcagtctcaagcctac
attcctgaagatgaaggagacttttattatgcagggggttattttggaggaaaaatagaa
gaggtctacaaactgactaaccactgccatcatgctatgctgacggacaaagcaaataac
attgaagctgtttggcatgatgagagttacctgaacaattactttctatattacaaaaag
cctactaagatcctctctccagagtatctgtggaatgaacgggatggtaccgcacactac
ctaaggaaaagaaggttaattgcacttcataaaaacccagatgaagtccggaactaa

DBGET integrated database retrieval system