KEGG   Xenopus laevis (African clawed frog): 496058Help
Entry
496058            CDS       T01010                                 

Gene name
dyrk3
Definition
dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 3
Orthology
K18669  
dual specificity tyrosine-phosphorylation-regulated kinase 2/3/4 [EC:2.7.12.1]
Organism
xla  Xenopus laevis (African clawed frog)
Brite
Enzymes [BR:xla01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     496058 (dyrk3)
Protein kinases [BR:xla01001]
 Serine/threonine protein kinases: CMGC group
  DYRK family [OT]
   496058 (dyrk3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
AA seq 567 aa AA seqDB search
MLLTRKPEGPIAAVRYGDGLYDSYMRLDQMAAQDAAEDKESPSTLPSFGRLAISGNKLAM
KDQQQVKVQQLFEDSSNRRVGAGVPSTESAFPLLTKEKSLDSSGTSKSSESSAKSSKATY
LAPEQAVKQYKHQLSAYELQEISSFSEIHFVGPNAKKRQGVVGGPNNGGYDDDQGGYNLV
PHDHVAYRYEVLKVIGKGSFGQVAKVYDHKLHQHLAVKMVRNEKRFHRQAAEEIRILEHL
KKQDKTGSMNVIHMLESFTFRNHICMTFELLSMNLYELIKRNKFQGFSLQLVRKFAHSIL
QCLEALYRNKIIHCDLKPENILLKQQGRSGIKVIDFGSSCFDHQRVYTYIQSRFYRAPEV
ILGSRYGMPIDIWSFGCILVELLTGYPLFPGEDEGDQLACMMELLGAPPPKLLEQAKRAK
NFINSKGYPRYCTVTTLPNGTTVLNGSRSRRGKMRGAPGCKDWVAALKGCEDTLFIDFLK
GCLTWDPVARMTPSQAMRHQWISKRLPKPSVTEKSSGKRITSQTSSFPGIGSKLPPVVGV
GNKLRANLMNDSNGSIPLRTVLPKLVS
NT seq 1704 nt NT seq  +upstreamnt  +downstreamnt
atgctcttgacaaggaagcctgagggccccatagcagcagtgagatatggtgatggcttg
tatgattcatatatgaggcttgatcagatggcagcacaagatgcggcagaggataaagaa
agcccgtccactctaccttcatttgggagacttgctataagtggaaataaacttgcaatg
aaggatcaacaacaagttaaagtacaacagttatttgaggactccagtaacagaagggtt
ggtgcaggtgttccaagtacagaaagtgcatttcccttgctgaccaaagagaagagttta
gacagctcaggaacttcaaagtctagtgagagctctgccaagtcatcaaaggccacatac
ctggctcctgagcaagcagtgaagcaatacaagcaccagctctctgcttatgaactacaa
gaaatcagtagtttttctgagatacattttgtgggtccaaatgcaaagaagagacaagga
gttgtaggcggtcctaataatggaggctacgatgatgatcaaggaggctacaatttggtg
ccacatgaccatgtggcataccgatatgaagttcttaaggttattgggaagggcagcttt
ggccaagttgcaaaggtttatgaccacaagcttcaccagcatttggcagtaaagatggtc
cggaatgaaaagagatttcaccggcaggctgcagaggagatccgcatcctggaacacctc
aagaaacaggacaagactggcagtatgaatgtgattcacatgctggagagtttcactttc
cgaaatcacatttgtatgacatttgagcttctcagcatgaatttatatgagttaatcaaa
cgaaacaagttccagggttttagtctgcaacttgttcgcaaatttgcccattcaatcctg
cagtgcttggaagctttatacaggaataagatcatccactgtgacctaaagcctgaaaat
atactcctcaaacagcaagggcgtagtggtattaaagtgatagattttggttctagttgc
tttgatcaccaaagagtctatacatatatacagtcccgtttctacagagcacctgaggtt
atactgggaagtcgttacggtatgcccattgatatatggagttttggttgcatattagtt
gagctccttactggttatccattgtttcctggtgaggatgagggagaccaactagcttgt
atgatggagcttcttggtgcgccacctccaaagcttctagaacaagccaaaagagcaaag
aactttattaactccaagggatacccacgctattgtactgtcaccacacttcctaatggg
acaacagttctcaatggcagcaggtcacgcagaggtaaaatgcgtggtgcgcctggctgc
aaagactgggttgcagctttgaagggctgtgaagatacccttttcatcgattttttgaag
ggttgtctcacctgggacccagttgcacgtatgacccctagccaggccatgcgacatcag
tggatttccaagcgattgcctaagccttcagtcactgagaagtcttcaggtaaaagaatt
accagccaaaccagctcttttccaggaattggctccaaactgcctccagtcgtaggcgtg
ggcaacaaattacgggccaatttaatgaatgactccaatggaagtataccacttcgaaca
gttctacccaagctagttagctaa

DBGET integrated database retrieval system