KEGG   Xenopus laevis (African clawed frog): 496104Help
Entry
496104            CDS       T01010                                 

Gene name
pde3b
Definition
phosphodiesterase 3b, cGMP-inhibited
Orthology
K13296  
cGMP-inhibited 3',5'-cyclic phosphodiesterase [EC:3.1.4.17]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
Purine metabolism
Insulin signaling pathway
Progesterone-mediated oocyte maturation
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:xla00230]
Organismal Systems; Endocrine system; Insulin signaling pathway [PATH:xla04910]
Organismal Systems; Endocrine system; Progesterone-mediated oocyte maturation [PATH:xla04914]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
AA seq 985 aa AA seqDB search
MKGPEGRNGYVRTSVRAVPAEPPCEELLRGLRFPLVLGALGVVALCGFPGVGQALSPLFT
IGSAYFFLSRSVWPRGALLALPLCCSLGEVLGLGAVLGSVGLVSLYQALRLGESVLLLLF
SSLIWLLTASGLGALPAGLRALGSCLAGLGGVLLALASRPAPPPRSSLVEADKVPVIRPR
RRSSCVSFGETPNSYYGGSKMGRRPSLPCISREQMILWDWDLKQWYKPQYQNAGGGNGVD
LSVLNEARNMVTDLLADPSLSPQVISSLRSISSSMGTFSGSCRPKINPFTPFPGFYPCTE
MEDPMDKVERKPHKGMNSRSSLPTPQLRRSSGASILPPMEPPPRWERSNGKRPHQEYMGA
SQGSYPNGPYSSNLLTIPKQRSSSVTLTHHIGPRRAGASPSLSPVNSPSLGSGFSRAPVE
FPDTADFLTKPSVTLHKTAGLASTSQDFQPQVRSPGSHICTSCGRPTLKAVSNAEVTDSS
CQSGTEQQSIQQAESGTGQKEAGHLKEKAQESRLQKDSRNEPGGRESQMKEESPLQELIQ
EQDSLLGRLDNWNFPIFDLVERTGGKSGRILSQVSYTLFQDTGLFEIFKIPLREFHNFFR
ALESGYRNIPYHNRIHATDVLHSVWYLSTRPIPGFQDINSDETDPDAEGGATQAYLASKT
CKLPDDSYGCLSSNIPALELMALYVAAAMHDYDHPGRTNAFLVATNAPQAVLYNDRSVLE
NHHAASAWNLFLSQPEYNFLSYLDHVQFKRFRFLVIEAILATDLKKHFDFLAEFNAKVND
VNGLGIDWSNENDRLLVCQVCIKLADINGPAKTRELHLKWTEGIVNEFYEQGDEESSLGL
PISPFMDRSAPQLAKLQESFITHIVGPLCNSYDAAGLLPGRWTEEDEEIEESDDNDDLDS
EEEEMEEDIDPKPPRRKRRRRILCPLIHHLRENHKVWKKTIEEEEKSKAEQTKQQNDGSS
GPDDIQVIEEDDEEEERQSGEERKC
NT seq 2958 nt NT seq  +upstreamnt  +downstreamnt
atgaagggaccggagggacggaacggctacgtgcggactagtgtgagagctgtgcccgcg
gaacccccgtgtgaggagctgctgcgcgggctgcgcttccctctggtgctgggggcgctg
ggagtggtcgctctgtgcggattcccgggggtgggtcaggcgctcagtcccctctttact
atcggctccgcctacttcttcctgagccgcagtgtgtggccccggggggcccttctggcg
ctgccgctttgctgctccctgggggaggtccttggactgggggcggttctgggctccgtg
gggctcgtgtctctgtatcaggcgctgagactgggggagtccgtgctgctccttctcttc
tccagtctcatctggctcctcactgcctctggcctcggggcccttcctgccggactccgg
gccctggggagctgcttggccggactggggggcgtgctcttggctttggcttctcgtcca
gccccgcccccgaggagcagtcttgtggaggcggataaagtcccggtgattcggccccgc
aggagatccagctgtgtgtccttcggagagacccccaattcgtactatgggggcagcaag
atgggccggagaccttccctaccctgtatctcccgtgagcagatgattctgtgggactgg
gatctgaagcagtggtacaaaccccaataccagaacgctggaggtggcaacggagttgat
ctgtcagtcctcaacgaggcgcgaaacatggtcaccgacctactggccgatccctccctc
tcaccccaagtgatctcctccctccgcagcatcagcagctcaatgggaaccttctcaggc
tcatgtagaccaaaaatcaaccccttcacccccttccctggcttctacccctgtactgaa
atggaggatcctatggataaagtagagcgtaaacctcacaaggggatgaacagtcgcagc
agtctgccaaccccccagctccgtcgcagctcaggggcatcaattctgcctcccatggag
ccgcctcctcggtgggaacgaagcaatggcaagaggccccaccaggaatacatgggtgcc
agccaaggatcatatccaaacggaccctacagttccaacctcctcacgataccaaagcaa
cggtcctcgtctgtaacgctgacccaccacattggccccaggagagctggtgcctcgccg
tccctcagtccagtgaattcccccagtcttggttctgggttcagtcgggcccccgttgaa
ttccccgacacggctgatttcctcaccaagcccagcgtgactctccataaaaccgcagga
ctcgcgtccacttctcaggatttccagccgcaggtccggtcgcccggcagccatatttgt
accagttgtgggcgtccgactctgaaggctgtttccaatgcagaagtgacagacagcagt
tgccagtcgggcacagagcagcagtctatacagcaggctgaaagtggaaccggccagaag
gaagcggggcatttaaaggagaaggcgcaggagagccgactgcagaaagactccaggaat
gagccagggggccgggaatcccagatgaaagaagagtcccccctgcaggagctgatccaa
gaacaggactcgctgttgggcagattagacaattggaactttcccatatttgatctggtg
gagcggacgggagggaagtcggggaggatcctcagtcaggtttcctacactctgtttcag
gacacgggtttatttgagattttcaaaatccctctacgagaattccacaacttcttcaga
gccttagaaagcggctaccggaatattccataccataaccgtattcacgccactgatgtg
ctccactccgtgtggtacctgagcacccggccaatcccagggttccaagatattaacagc
gacgaaacagatccagatgcagagggcggagccacacaagcgtacttggcatcaaagact
tgcaagcttccagatgatagctatgggtgtctctcatccaatatccctgcacttgagtta
atggccctgtatgtggcagcagccatgcacgactatgaccaccccggtcgcacaaatgca
tttctcgtggccaccaatgcaccgcaggctgttctttacaatgaccggtcagtgctggag
aatcatcacgcagcctcagcctggaacctctttctgtcgcagccggaatacaatttcctc
tcctacttggaccatgtgcagttcaagagatttcgattcctggtgatagaagccatactc
gccaccgacctcaaaaagcattttgactttcttgctgagttcaatgccaaggtcaatgat
gtgaatggacttggcatcgactggagcaacgagaatgaccgcctcctggtttgccaagtc
tgcattaaactggccgacatcaatgggccggcaaaaacccgggaattgcacttaaagtgg
acagaaggaattgtgaatgaattctatgagcagggagatgaagagtcaagtctgggactc
cccatcagcccattcatggaccgttccgctccacaactcgcaaagctgcaggaatctttc
attactcacatagtggggcccctgtgtaactcgtacgatgccgccggcctgctgcccggg
agatggaccgaggaggatgaggagatcgaggaaagtgatgacaacgacgatttggattca
gaagaggaagaaatggaggaagatattgatccaaaacctccgaggcggaaaagaaggagg
cggatactttgcccactgatccatcacctccgggagaaccacaaggtctggaagaaaacc
atcgaggaagaggagaagagcaaagccgagcaaacgaaacagcagaacgacggcagctct
gggcctgacgacattcaggtcattgaggaagatgacgaggaagaagagcgacaatccggg
gaggagagaaaatgctga

DBGET integrated database retrieval system