KEGG   Xenopus laevis (African clawed frog): 496104Help
Entry
496104            CDS       T01010                                 

Gene name
pde3b.L, pde3b, pde3b.S
Definition
(RefSeq) phosphodiesterase 3B L homeolog
  KO
K13296  
cGMP-inhibited 3',5'-cyclic phosphodiesterase B [EC:3.1.4.17]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
Purine metabolism
Apelin signaling pathway
Insulin signaling pathway
Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:xla00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    496104 (pde3b.L)
 Environmental Information Processing
  Signal transduction
   04371 Apelin signaling pathway
    496104 (pde3b.L)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    496104 (pde3b.L)
   04914 Progesterone-mediated oocyte maturation
    496104 (pde3b.L)
Enzymes [BR:xla01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.17  3',5'-cyclic-nucleotide phosphodiesterase
     496104 (pde3b.L)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Xenbase: 
Position
4L
AA seq 985 aa AA seqDB search
MKGPEGRNGYVRTSVRAVPAEPPCEELLRGLRFPLVLGALGVVALCGFPGVGQALSPLFT
IGSAYFFLSRSVWPRGALLALPLCCSLGEVLGLGAVLGSVGLVSLYQALRLGESVLLLLF
SSLIWLLTASGLGALPAGLRALGSCLAGLGGVLLALASRPAPPPRSSLVEADKVPVIRPR
RRSSCVSFGETPNSYYGGSKMGRRPSLPCISREQMILWDWDLKQWYKPQYQNAGGGNGVD
LSVLNEARNMVTDLLADPSLSPQVISSLRSISSSMGTFSGSCRPKINPFTPFPGFYPCTE
MEDPMDKVERKPHKGMNSRSSLPTPQLRRSSGASILPPMEPPPRWERSNGKRPHQEYMGA
SQGSYPNGPYSSNLLTIPKQRSSSVTLTHHIGPRRAGASPSLSPVNSPSLGSGFSRAPVE
FPDTADFLTKPSVTLHKTAGLASTSQDFQPQVRSPGSHICTSCGRPTLKAVSNAEVTDSS
CQSGTEQQSIQQAESGTGQKEAGHLKEKAQESRLQKDSRNEPGGRESQMKEESPLQELIQ
EQDSLLGRLDNWNFPIFDLVERTGGKSGRILSQVSYTLFQDTGLFEIFKIPLREFHNFFR
ALESGYRNIPYHNRIHATDVLHSVWYLSTRPIPGFQDINSDETDPDAEGGATQAYLASKT
CKLPDDSYGCLSSNIPALELMALYVAAAMHDYDHPGRTNAFLVATNAPQAVLYNDRSVLE
NHHAASAWNLFLSQPEYNFLSYLDHVQFKRFRFLVIEAILATDLKKHFDFLAEFNAKVND
VNGLGIDWSNENDRLLVCQVCIKLADINGPAKTRELHLKWTEGIVNEFYEQGDEESSLGL
PISPFMDRSAPQLAKLQESFITHIVGPLCNSYDAAGLLPGRWTEEDEEIEESDDNDDLDS
EEEEMEEDIDPKPPRRKRRRRILCPLIHHLRENHKVWKKTIEEEEKSKAEQTKQQNDGSS
GPDDIQVIEEDDEEEERQSGEERKC
NT seq 2958 nt NT seq  +upstreamnt  +downstreamnt
atgaagggaccggagggacggaacggctacgtgcggactagtgtgagagctgtgcccgcg
gaacccccgtgtgaggagctgctgcgcgggctgcgcttccctctggtgctgggggcgctg
ggagtggtcgctctgtgcggattcccgggggtgggtcaggcgctcagtcccctctttact
atcggctccgcctacttcttcctgagccgcagtgtgtggccccggggggcccttctggcg
ctgccgctttgctgctccctgggggaggtccttggactgggggcggttctgggctccgtg
gggctcgtgtctctgtatcaggcgctgagactgggggagtccgtgctgctccttctcttc
tccagtctcatctggctcctcactgcctctggcctcggggcccttcctgccggactccgg
gccctggggagctgcttggccggactggggggcgtgctcttggctttggcttctcgtcca
gccccgcccccgaggagcagtcttgtggaggcggataaagtcccggtgattcggccccgc
aggagatccagctgtgtgtccttcggagagacccccaattcgtactatgggggcagcaag
atgggccggagaccttccctaccctgtatctcccgtgagcagatgattctgtgggactgg
gatctgaagcagtggtacaaaccccaataccagaacgctggaggtggcaacggagttgat
ctgtcagtcctcaacgaggcgcgaaacatggtcaccgacctactggccgatccctccctc
tcaccccaagtgatctcctccctccgcagcatcagcagctcaatgggaaccttctcaggc
tcatgtagaccaaaaatcaaccccttcacccccttccctggcttctacccctgtactgaa
atggaggatcctatggataaagtagagcgtaaacctcacaaggggatgaacagtcgcagc
agtctgccaaccccccagctccgtcgcagctcaggggcatcaattctgcctcccatggag
ccgcctcctcggtgggaacgaagcaatggcaagaggccccaccaggaatacatgggtgcc
agccaaggatcatatccaaacggaccctacagttccaacctcctcacgataccaaagcaa
cggtcctcgtctgtaacgctgacccaccacattggccccaggagagctggtgcctcgccg
tccctcagtccagtgaattcccccagtcttggttctgggttcagtcgggcccccgttgaa
ttccccgacacggctgatttcctcaccaagcccagcgtgactctccataaaaccgcagga
ctcgcgtccacttctcaggatttccagccgcaggtccggtcgcccggcagccatatttgt
accagttgtgggcgtccgactctgaaggctgtttccaatgcagaagtgacagacagcagt
tgccagtcgggcacagagcagcagtctatacagcaggctgaaagtggaaccggccagaag
gaagcggggcatttaaaggagaaggcgcaggagagccgactgcagaaagactccaggaat
gagccagggggccgggaatcccagatgaaagaagagtcccccctgcaggagctgatccaa
gaacaggactcgctgttgggcagattagacaattggaactttcccatatttgatctggtg
gagcggacgggagggaagtcggggaggatcctcagtcaggtttcctacactctgtttcag
gacacgggtttatttgagattttcaaaatccctctacgagaattccacaacttcttcaga
gccttagaaagcggctaccggaatattccataccataaccgtattcacgccactgatgtg
ctccactccgtgtggtacctgagcacccggccaatcccagggttccaagatattaacagc
gacgaaacagatccagatgcagagggcggagccacacaagcgtacttggcatcaaagact
tgcaagcttccagatgatagctatgggtgtctctcatccaatatccctgcacttgagtta
atggccctgtatgtggcagcagccatgcacgactatgaccaccccggtcgcacaaatgca
tttctcgtggccaccaatgcaccgcaggctgttctttacaatgaccggtcagtgctggag
aatcatcacgcagcctcagcctggaacctctttctgtcgcagccggaatacaatttcctc
tcctacttggaccatgtgcagttcaagagatttcgattcctggtgatagaagccatactc
gccaccgacctcaaaaagcattttgactttcttgctgagttcaatgccaaggtcaatgat
gtgaatggacttggcatcgactggagcaacgagaatgaccgcctcctggtttgccaagtc
tgcattaaactggccgacatcaatgggccggcaaaaacccgggaattgcacttaaagtgg
acagaaggaattgtgaatgaattctatgagcagggagatgaagagtcaagtctgggactc
cccatcagcccattcatggaccgttccgctccacaactcgcaaagctgcaggaatctttc
attactcacatagtggggcccctgtgtaactcgtacgatgccgccggcctgctgcccggg
agatggaccgaggaggatgaggagatcgaggaaagtgatgacaacgacgatttggattca
gaagaggaagaaatggaggaagatattgatccaaaacctccgaggcggaaaagaaggagg
cggatactttgcccactgatccatcacctccgggagaaccacaaggtctggaagaaaacc
atcgaggaagaggagaagagcaaagccgagcaaacgaaacagcagaacgacggcagctct
gggcctgacgacattcaggtcattgaggaagatgacgaggaagaagagcgacaatccggg
gaggagagaaaatgctga

DBGET integrated database retrieval system