KEGG   Xenopus laevis (African clawed frog): 496242Help
Entry
496242            CDS       T01010                                 

Gene name
gpx1, gshpx1
Definition
glutathione peroxidase 1 (EC:1.11.1.9)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:xla00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    496242 (gpx1)
  Metabolism of other amino acids
   00480 Glutathione metabolism
    496242 (gpx1)
Enzymes [BR:xla01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     496242 (gpx1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
AA seq 143 aa AA seqDB search
MSKLQSTYGSRGLQVLAFPCNQFGHQENSNNQEILNLLKYVRPGGGFEPNFPLFEKVDVN
GEKEHPLFTFLKEQLPYPSDDSISLMQDPKSIIWSPVRRNDIAWNFEKFLITKNGVPYKR
YGRRFETVNIQQDIEKLLHENCA
NT seq 432 nt NT seq  +upstreamnt  +downstreamnt
atgagcaagctgcagagcacgtatggctcccgcgggctgcaggtcctcgccttcccctgt
aaccagttcggacaccaggagaacagcaacaaccaagaaattctgaaccttctgaagtat
gtccgtcccgggggtggctttgaaccaaacttccccctctttgagaaggtcgatgttaat
ggagaaaaggagcatcctctctttactttcctgaaggagcaacttccatatcccagcgac
gactccatttccctcatgcaggatcccaagagtatcatctggtctcctgtgcgtaggaat
gacattgcgtggaactttgagaagttccttatcactaagaatggggtcccgtacaagcga
tatggccgtcgcttcgagacagtcaacatccagcaagacatagagaagctgcttcatgaa
aattgtgcatag

  All links  
No link information was found.   
DBGET integrated database retrieval system