KEGG   Xenopus laevis (African clawed frog): 496247Help
Entry
496247            CDS       T01010                                 

Gene name
anapc11
Definition
anaphase promoting complex subunit 11
Orthology
K03358  
anaphase-promoting complex subunit 11
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
Cell cycle
Oocyte meiosis
Ubiquitin mediated proteolysis
Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:xla00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    496247 (anapc11)
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    496247 (anapc11)
   04114 Oocyte meiosis
    496247 (anapc11)
 Organismal Systems
  Endocrine system
   04914 Progesterone-mediated oocyte maturation
    496247 (anapc11)
Ubiquitin system [BR:xla04121]
 Ubiquitin ligases (E3)
  multi subunit Ring-finger type E3
   APC/C
    Ring finger protein
     496247 (anapc11)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
AA seq 84 aa AA seqDB search
MKVRLKCWNGVASWQWVANDDNCGICRMAFNGCCPECKIPGDDCPLVWGHCSHCFHMHCI
LKWLNSQQVQQHCPMCRQEWKFKE
NT seq 255 nt NT seq  +upstreamnt  +downstreamnt
atgaaggttcgcctcaagtgctggaatggtgttgcctcctggcagtgggtggccaacgat
gacaactgtgggatatgtcgtatggcatttaatgggtgctgtccagaatgtaaaatccca
ggagatgactgcccattggtgtggggtcactgctctcactgcttccatatgcattgcatc
ttaaaatggctgaattcccaacaggtgcagcagcactgccccatgtgtcgccaagaatgg
aaattcaaagagtga

DBGET integrated database retrieval system